(data stored in ACNUC7421 zone)

EMBL: CP001069.PE233

CP001069.PE233       Location/Qualifiers
FT   CDS_pept        274768..275205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4004"
FT                   /product="transmembrane pair domain protein"
FT                   /note="PFAM: transmembrane pair domain protein; KEGG:
FT                   rso:RS04790 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4004"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29109"
FT                   /db_xref="GOA:B2UHQ8"
FT                   /db_xref="InterPro:IPR007896"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHQ8"
FT                   /protein_id="ACD29109.1"
FT                   /translation="MQVIQKTPAERLVHALTFELVAMLICAPLFSWLMELPLAEMGVMT
FT                   LMFAAVAMVWNMVFNAIFERVERRYRLSRTLVLRVVHACLFEGGLVLMLVPLAAWWLDV
FT                   GLWEAFVLDIGIMLLFLPYTFFFNLAYDHLRARWMSRRALA"
     atgcaagtca tacagaaaac gccagctgag cgccttgtgc atgcgctgac gttcgagttg        60
     gttgccatgc tgatttgtgc gccgttgttc agctggctga tggaactgcc gttggctgag       120
     atgggtgtga tgacgctcat gtttgctgcg gtggcgatgg tgtggaacat ggtgttcaac       180
     gccatcttcg agcgcgtgga gcgtcgctac aggctctcgc gtaccttggt gctgcgggtg       240
     gtgcatgcct gcctgttcga gggcgggttg gtcttgatgc tggtgccgct ggccgcctgg       300
     tggctcgacg tggggctgtg ggaagcgttc gtgctcgaca tcggcatcat gctgctgttc       360
     ctgccgtaca ccttcttctt caacctcgca tacgaccatc tgcgcgcacg ttggatgtcg       420
     cgtcgcgcgc tggcctga                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page