(data stored in ACNUC7421 zone)

EMBL: CP001069.PE234

CP001069.PE234       Location/Qualifiers
FT   CDS_pept        275320..275961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4005"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; KEGG: rso:RS04789
FT                   putative transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4005"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29110"
FT                   /db_xref="GOA:B2UHQ9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHQ9"
FT                   /protein_id="ACD29110.1"
FT                   /translation="MPRLSVTSPHASATVLRQCYVAACAGDAVGVMNVLRDACGADHAA
FT                   AMIRWRVDGRWHWAASRGARSADVLLHAVRGDGVDAWPMADAEVRGAVWLDYRKAGVPQ
FT                   PMQHGAAPQALLPHFAQALPLCWRRVAARAGISPAQPASLWLTDAFHLTRREADVADLL
FT                   ASGSDPACIARTLGISLDTVRTHLKHVYRKTNTHSQCDVVRLMLALSARR"
     atgccgcgtc tttctgtcac gtcacctcat gcctcggcaa ccgtgctgcg ccaatgctac        60
     gtagcggcgt gcgcgggcga tgccgtgggc gtgatgaacg tgctgcgcga tgcgtgcggc       120
     gcggaccatg cagcggccat gatccggtgg cgcgtcgatg ggaggtggca ctgggcggca       180
     tcgcgcggcg cacgctcggc cgacgtgctg ctgcatgcgg tacgcggtga cggcgtcgac       240
     gcgtggccga tggccgatgc ggaagtgcgc ggggcggtgt ggctcgatta ccgcaaggcg       300
     ggcgtgccgc aacccatgca gcatggtgcg gcgccacaag cgttgctgcc gcactttgcg       360
     caagcactgc cgttgtgctg gcgacgcgtt gcggcgcgcg cgggcatttc gcctgcgcag       420
     ccggccagcc tctggctgac cgacgcattc cacctgacgc gccgcgaagc cgatgttgcc       480
     gatctgctcg caagcggctc cgacccagcc tgcattgccc gcacgctagg catttcactc       540
     gacacggtgc gcacgcacct caaacacgtc taccgcaaga ccaacacgca cagccagtgc       600
     gacgtggtgc ggctgatgct ggcgctgtct gcgcgccggt ag                          642
//

If you have problems or comments...

PBIL Back to PBIL home page