(data stored in ACNUC7421 zone)

EMBL: CP001069.PE238

CP001069.PE238       Location/Qualifiers
FT   CDS_pept        complement(278658..279554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4010"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rso:RS03033 probable
FT                   transmembrane ABC transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4010"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29114"
FT                   /db_xref="GOA:B2UHR3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHR3"
FT                   /protein_id="ACD29114.1"
FT                   /translation="MQTETLSMPATTDISNRAPVYSTPVAFERIGVVEKPLSVAERLYE
FT                   QAWLRKVVILVVLALVWEGGARWLDNPLLLPTFSDTVQALWAGLASGTLFARIGTSMQT
FT                   LLAGYALGLALSCALVVLGISNRLGQDFLETLTAMFNPLPAIALLPIALVWFGLGNGSL
FT                   IFVIVHSVVWAVSLNTHAGFLSVSNTLRMVGRNYGLSGMGYLTKILIPAAFPSILTGLK
FT                   IGWAFAWRTLIASELVFGVSSGQGGLGWYIYENKNQLQIPEVFAGLLTVIIIGLLVENL
FT                   VFRTLEARTVKRWGMQN"
     atgcagactg aaaccctttc catgccggcc accaccgaca tcagcaaccg cgcgcccgtc        60
     tacagcacgc ccgtggcgtt cgagcgcatc ggcgtggtgg aaaaacccct ctccgttgcg       120
     gagcgtttgt acgaacaggc atggctgcgc aaggtcgtca tcctcgtcgt gctcgcactg       180
     gtgtgggaag gcggggcgcg ctggctcgac aacccgctgt tgcttccgac tttttccgac       240
     accgtgcagg cgctgtgggc agggttggcg agcggcacgc tgtttgctcg catcggcacg       300
     tcgatgcaaa cgctgcttgc aggctacgcg ctcggcttgg cgttgtcctg cgcgctggtc       360
     gtgctcggca tcagcaaccg gctcgggcag gacttcctgg aaacgctcac cgccatgttc       420
     aacccgctgc cggccattgc gctgctgcca atcgccctcg tgtggttcgg cctgggcaac       480
     ggcagcctga tcttcgtgat cgtgcattcg gtggtgtggg cggtgtcgct caacacgcat       540
     gccggtttcc tgtcggtatc gaacacgctg cgcatggtgg gccgcaacta cgggctatcc       600
     ggcatgggat acctgacgaa gatcctgatc cccgccgcat tcccgtccat cctcactggc       660
     ctgaagatcg gctgggcctt cgcatggcgc acgttgatcg cctcggaact ggtgtttggc       720
     gtcagctccg gccagggcgg cctcggctgg tacatctacg agaacaagaa ccaactgcaa       780
     attcccgaag tgttcgccgg cctgctgacg gtgatcatca tcggcctgct ggtagagaac       840
     ctcgtgttcc gtacgcttga agcccgtacc gtcaagcgct ggggcatgca gaactaa          897
//

If you have problems or comments...

PBIL Back to PBIL home page