(data stored in ACNUC7421 zone)

EMBL: CP001069.PE239

CP001069.PE239       Location/Qualifiers
FT   CDS_pept        complement(279544..280338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4011"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rso:RS03034 probable ATP-binding ABC transporter
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4011"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29115"
FT                   /db_xref="GOA:B2UHR4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHR4"
FT                   /protein_id="ACD29115.1"
FT                   /translation="MQANSPTAPPLLDVRGVTLQYKTRQHLVTATYRVDFQVYPGERYI
FT                   LLGPSGCGKSTLLKAIGGYLTPTEGEIRLKGQPVTKPGPDRMMVFQEFDQLLPWKTVKE
FT                   NVLFPLLSTGKLGAREAEERALHYINKVNLTKFADHHPHMLSGGMKQRVAIARGMAMEP
FT                   DVLLMDEPFAALDALTRRKMQDELLQLWDETRFTVLFVTHSIPEAIRCGSRILILSPHP
FT                   GQVRAELPSLARGDDDPERFKALEAEIHDMLFARAVEETHAD"
     atgcaggcca actcaccaac ggcaccgccg ctgctggacg tgcgcggcgt cacgctgcag        60
     tacaagacac gccagcatct ggtgacggcc acctaccgcg tcgatttcca ggtctacccc       120
     ggcgagcgct atatcctgct tgggccgtcg ggctgcggta aatcgacact gctcaaggcc       180
     atcggcggct acctcacacc caccgagggc gagatccgtc tcaagggcca gcccgtgacg       240
     aagccggggc cggatcgcat gatggtgttc caggagttcg accagctcct gccgtggaag       300
     accgtgaagg aaaacgtgct gttcccgctg ctctccacgg gcaagctggg cgcgcgtgaa       360
     gccgaagagc gcgcgctgca ctacatcaac aaggtcaacc tcacgaagtt tgccgaccac       420
     cacccgcaca tgctgtctgg ggggatgaag cagcgtgtgg cgattgcgcg cggcatggcc       480
     atggagcccg acgtgctgct gatggacgag cccttcgccg cgctcgatgc gctcacgcgc       540
     cgcaagatgc aggacgagtt gctgcagctg tgggacgaaa cgcgcttcac cgtgctgttc       600
     gtcacgcact cgattccgga ggcgatccgc tgcggcagcc gcatcctgat cctgtcgccg       660
     catcccggcc aggtacgcgc cgaactgccg agccttgcgc gcggcgatga tgacccggag       720
     cgcttcaaag ccctcgaagc cgagatccac gacatgctgt tcgcccgcgc ggtggaggaa       780
     acccatgcag actga                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page