(data stored in ACNUC7421 zone)

EMBL: CP001069.PE240

CP001069.PE240       Location/Qualifiers
FT   CDS_pept        complement(280395..281117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4012"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; UbiC
FT                   transcription regulator-associated domain protein; KEGG:
FT                   rso:RS03035 probable transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4012"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29116"
FT                   /db_xref="GOA:B2UHR5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHR5"
FT                   /protein_id="ACD29116.1"
FT                   /translation="MPADLRLPRYQQLRDDLAAQIAQQHWRPGDAIPTEAELAKTYNVA
FT                   VGTVRKAVDVLVAEGLLERFQGRGTFVRRASFASSLFRFFRFQSESGERRIPESRILKR
FT                   DVLDAPSAPAAGLQIETGAPVIRLTRLRLLDGAPMLAEEIWLPYDRFASLATLELNAFG
FT                   DLLYPLYESHCGQIIASAEETLTAEAVNATYARLLRIQPGDPVMVIERVARGYDRVPLE
FT                   WRRSRGAAAHFRYHVDIR"
     atgcccgccg atctccgcct gccccgctac cagcaattgc gcgacgatct ggccgcgcag        60
     atcgcccaac agcactggcg cccgggcgac gccatcccga ccgaagccga gcttgccaag       120
     acgtacaacg tggcggtcgg caccgtccgc aaagccgtag acgtactggt ggccgaaggg       180
     ctgctcgaac gcttccaggg ccgtggcacc tttgtgcggc gtgccagctt tgccagttcc       240
     ttgttccgct tcttccgctt ccagagtgaa agcggcgagc ggcgcattcc tgagagccgc       300
     atcctcaagc gggacgtgct ggatgccccg tcggcaccgg ctgcaggcct gcagattgaa       360
     accggcgcac cggtcattcg cctgacccgg ctgcgcctgc tggatggcgc acccatgctg       420
     gccgaagaaa tctggttgcc atatgaccgt tttgcgtcgc tcgccacgct ggaactcaac       480
     gcgtttggcg acctgctgta tccgctgtac gaatcgcact gcggccagat cattgcgagc       540
     gccgaagaaa cgctcaccgc cgaagccgtc aacgcaacgt atgcgcgcct gttgcgcatc       600
     cagcccggcg atccggtgat ggtcatcgaa cgcgttgcgc gcggctacga ccgggtgccg       660
     ctcgaatggc ggcgttcgcg cggcgcggcg gcgcacttcc ggtaccacgt ggatatccgg       720
     taa                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page