(data stored in ACNUC7421 zone)

EMBL: CP001069.PE242

CP001069.PE242       Location/Qualifiers
FT   CDS_pept        complement(283573..283863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4014"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_4922 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4014"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29118"
FT                   /db_xref="InterPro:IPR018720"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHR7"
FT                   /protein_id="ACD29118.1"
FT                   /translation="MTQSASTIQLDLRVLAPRERHPLIFSAFGELGIGQSLELINDHDP
FT                   RPLQSQFQVERPGQFSWDYLERGPGTWRVAITKVASAASAGHCCGGCGGGA"
     atgacacagt ccgcctccac catccagctc gacctccgcg tgctggcgcc gcgcgagcgc        60
     catccgctga tcttctccgc ctttggggaa ctcggcatcg ggcagagcct ggagctgatc       120
     aacgatcacg atccgcggcc gctgcagtcg cagtttcaag tcgaacgccc ggggcagttt       180
     tcctgggact accttgagcg cggccccggc acgtggcgcg tggccatcac caaggtggcg       240
     tctgccgcca gtgccggcca ctgctgcggt ggttgcggtg gtggcgcctg a                291
//

If you have problems or comments...

PBIL Back to PBIL home page