(data stored in SCRATCH zone)

EMBL: CP001069.PE247

CP001069.PE247       Location/Qualifiers
FT   CDS_pept        complement(287889..288656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4019"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: reh:H16_A0071 transcriptional regulator,
FT                   GntR-family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4019"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29123"
FT                   /db_xref="GOA:B2UHS2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHS2"
FT                   /protein_id="ACD29123.1"
FT                   /translation="MWCIFPILVTSVTQPLLQSPRLRTLGMSAEIASRLRTLIEEGELP
FT                   PGARIDERAFCEMFDVSKTPLREALKVLVAEGLVLHRQYIGYRVAPLDLDELRATFETL
FT                   HGLEFTAGELAAARLSEVALARLERRHQAMLDAHAAGRRTEYFRINQEIHQLIIDGTAN
FT                   PVLAGIYAALMSRVHRARGAANADMLRWQESHEEHEAIMAALREPGRPRLAQVLRHHSE
FT                   NTAKEVLSVVANSLAEASRPTRSTKESPKKGAQ"
     ttgtggtgca tcttccccat tctggtgacg tctgtgaccc aaccgctgct ccaatcccct        60
     cgcctgcgca cgctcggcat gtcggccgaa atcgcctcgc gtctgcgcac cctcatcgaa       120
     gaaggcgaat tgccgcccgg cgcccgtatc gacgagcgtg cgttctgtga aatgttcgat       180
     gtctccaaga cgccgctgcg cgaggcgctc aaggtgttgg tggccgaggg tctggtgctg       240
     catcgtcagt acatcggcta ccgcgttgca ccgctcgatc tcgatgaact gcgcgcgacc       300
     ttcgaaacgc tgcatgggct ggaattcacg gcaggagaac tggcggcggc ccgtctgtcc       360
     gaggtggctc ttgcgcgcct ggaacgcagg caccaggcga tgctcgacgc gcacgcggca       420
     ggccggcgca ccgagtactt ccgcatcaac caggaaattc accaactcat catcgacggc       480
     acggccaacc ccgtactggc cggcatttat gcggcgttga tgagcagggt gcaccgcgcg       540
     cgcggcgcag ccaacgcgga catgctgcgc tggcaggaat cgcacgaaga acacgaagcc       600
     atcatggccg cccttcgcga gccagggcgc ccgcgccttg cacaagtgct gcggcaccac       660
     tccgagaaca ccgccaagga agtgctgagc gtcgtggcaa acagcctcgc cgaggccagc       720
     cgcccaaccc gatcaaccaa ggaatccccc aagaaaggag cgcaatga                    768
//

If you have problems or comments...

PBIL Back to PBIL home page