(data stored in SCRATCH zone)

EMBL: CP001069.PE253

CP001069.PE253       Location/Qualifiers
FT   CDS_pept        complement(293966..294670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4026"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="PFAM: cyclic nucleotide-binding; KEGG: bra:BRADO5261
FT                   putative transcriptional regulator with cAMP binding domain
FT                   belongs to HTH Crp family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4026"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29129"
FT                   /db_xref="GOA:B2UHS8"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHS8"
FT                   /protein_id="ACD29129.1"
FT                   /translation="MAEHDTNSRPGISRARLAHIAAWSIDLPAEEADRACAGIVEKTYA
FT                   RGACICPKNTLLESWTGVVTGLIKIGTVSPEGRSVTFTGVPAGGWFGEGTVLKNEPRRY
FT                   DIVALRDTRMAFMERATFMWLVENSVAFNRFLVKQLNERLGHFMALLEYDRLLDVTPRL
FT                   ARCIASLFNPVLYPGAGDHLEITQEELGLLSGMTRQVANQSLKTLEKDGVVRLEYGGVT
FT                   VVDLDRLRSYGA"
     gtggctgaac acgatacaaa ctcgcgcccc ggcatcagcc gcgcacggct ggcgcatatc        60
     gcggcgtggt cgattgatct gcccgcggaa gaagccgacc gcgcctgcgc cggcatcgtt       120
     gaaaaaacct acgcacgcgg cgcgtgcatc tgcccgaaaa acacgttgct ggaaagctgg       180
     acgggcgtgg tcacgggcct catcaaaatc ggcacggtat cgcccgaggg gcgcagcgtc       240
     acgtttacgg gcgtgcctgc cggcggctgg tttggcgaag gcacggtgct caagaacgag       300
     ccgcgccgct acgacatcgt tgcgctgcgc gacacacgca tggccttcat ggagcgcgcc       360
     accttcatgt ggctggtgga aaacagcgtg gcgttcaacc gcttcctggt caagcagctc       420
     aacgagcggc tcgggcattt catggcgctg ctggaatacg accggctgct tgatgtcacg       480
     ccgcgcctgg cgcgttgcat tgcgtcgctg ttcaacccgg ttctctaccc cggcgcgggc       540
     gaccacctgg agatcacgca ggaagaactc ggcctgcttt ccggcatgac gcgccaagtt       600
     gccaaccagt cgctcaagac cctggagaag gacggcgtgg tgcggctgga atacggcggc       660
     gtgacggtcg tggacctcga tcggctgcgc agctacggcg cctga                       705
//

If you have problems or comments...

PBIL Back to PBIL home page