(data stored in ACNUC7421 zone)

EMBL: CP001069.PE257

CP001069.PE257       Location/Qualifiers
FT   CDS_pept        297014..298231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4030"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger; KEGG: rso:RS03045
FT                   probable cation-efflux system transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4030"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29133"
FT                   /db_xref="GOA:B2UHT2"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHT2"
FT                   /protein_id="ACD29133.1"
FT                   /translation="MHVDTPLISTIIGGIVLAFIFGTIAQRLRLPPLVGYLMAGVVAGP
FT                   FTPGFVADQSLAPQLAELGVILLMFGVGLHFSMKELLAVKAIAIPGAIGQIALATLMGM
FT                   GLAWLLGWDWGPGLVFGLALSVASTVVLLKALEDRGIDNSHEGHIAVGWLIVEDLVMVV
FT                   TLVLLPALAGALGGAGSTAVGAWDIIKVLAVTLSKVVAFAALMLVVGRRVIPWMLERIV
FT                   MTGSRELFRLGVLATALGVAYGATVLFGVSFALGAFFAGMVLAESEFSQRAAEESLPLR
FT                   DAFAVLFFVSVGMLFDPSVLIEDPWAVLGTVLIVVVGKSLAAFAVVRAFGHGNRTALTI
FT                   SASLAQIGEFSFILIGLGISLEILPDRARGLLLSAAILSILLNPLMFALINRLKREVAP
FT                   EPATAD"
     atgcacgtag acaccccgct catctccacc atcatcggtg gcatcgtgct ggccttcatc        60
     ttcggcacca ttgcgcagcg cctgcgcctg ccgccactgg tcggctacct gatggcgggt       120
     gtggtggcgg ggccgttcac gcccggtttc gtggccgacc aaagcctcgc gccgcaactg       180
     gccgagctgg gcgtgatcct cctgatgttc ggggtggggt tgcatttctc gatgaaggag       240
     ctgctggcgg tcaaggccat cgccattccg ggtgccatcg ggcagattgc gttggccacg       300
     ctcatgggta tgggcctggc gtggctgctt gggtgggact ggggcccggg gctggtgttc       360
     gggctggcgc tgtcggtggc gagcacggtg gtgctgctca aggcgctgga ggatcgcggc       420
     atcgacaact cgcacgaagg ccatatcgcc gtgggctggc tgatcgtgga agacctcgtg       480
     atggtggtga cgctggtgct gctgccggcc ttggccggtg cgctgggcgg cgcaggcagc       540
     acagcggtcg gcgcatggga catcatcaag gtgctggcgg tcacgctctc gaaggtggtg       600
     gcgtttgccg cgctcatgct ggtggtgggc cgccgcgtga tcccctggat gctggagcgt       660
     atcgtcatga cgggcagccg ggagctgttc cgcctgggtg tgctggccac ggcgctgggc       720
     gtcgcttatg gcgcgacggt gctgtttggc gtgtcgttcg cactcggcgc gttctttgcg       780
     ggcatggtgc tggccgagtc cgaattcagt cagcgcgcgg cggaagagtc gctgccgctg       840
     cgcgatgcat ttgcggtgct gttcttcgta tcggtgggca tgctgttcga cccgagcgtg       900
     ctgatcgaag acccctgggc ggtgctcggc acggtgctga tcgtggtggt gggcaagtcg       960
     ctggccgcgt ttgcggtagt gcgcgcgttt ggtcacggca accgcacggc gctcacgatt      1020
     tcggccagcc ttgcgcagat cggcgagttt tcgttcatcc tgatcgggct ggggatcagc      1080
     ctggaaatcc tgcccgaccg tgcacggggc ctattgttgt cggcagcgat tctatcgatt      1140
     ctgctgaacc ccctgatgtt tgccctgatc aaccgtctca aacgcgaggt ggccccggag      1200
     ccggcgacgg cggattga                                                    1218
//

If you have problems or comments...

PBIL Back to PBIL home page