(data stored in ACNUC7421 zone)

EMBL: CP001069.PE258

CP001069.PE258       Location/Qualifiers
FT   CDS_pept        298275..298829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4031"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   rso:RS03046 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4031"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29134"
FT                   /db_xref="GOA:B2UHT3"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHT3"
FT                   /protein_id="ACD29134.1"
FT                   /translation="MSNLTIGVIVGSLRKASFNRQLAQALSGLLPSGATAQFIEIGELP
FT                   LYNQDLDASLPEPVQRFKAAVAGVDALLFVTPEYNRGIPGVLKNAIDWGSRPYGQSVWD
FT                   GKPAGIAGASPGAIGTALSQAQLRNVLAAVGVKVLPLPEVFFHFAGEPFDAQGGVTDAR
FT                   TRQFLQGFVDRFVQWAGQKPA"
     atgagcaatc tgactatcgg agtgatcgtc ggcagcctgc gcaaggcgtc gttcaaccgc        60
     cagctggcgc aggcgctgtc gggcttgttg ccgtcgggcg cgaccgcgca gttcatcgag       120
     attggcgagc tgccgctgta caaccaggac ctggacgcga gcctgcccga gccggtacag       180
     cgcttcaagg cggcggtggc gggcgtggat gccctgttat tcgtcacgcc ggaatacaac       240
     cggggcatac cgggcgtgct gaagaacgcg attgactggg gttcgcggcc gtacggccag       300
     agcgtgtggg acggcaagcc ggcaggcatt gcgggcgcat cgccaggcgc aattggcact       360
     gcactgtcgc aggcgcaatt gcgcaatgtg ctcgcggcgg tcggcgtgaa ggtcttaccg       420
     ttgccggagg tgtttttcca ctttgcgggg gagccctttg atgcccaggg cggggtgacg       480
     gatgcgcgta cgcgccagtt cttgcagggg tttgtcgacc gattcgttca gtgggcaggt       540
     cagaagccag cctga                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page