(data stored in ACNUC7421 zone)

EMBL: CP001069.PE26

CP001069.PE26        Location/Qualifiers
FT   CDS_pept        28088..29041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3786"
FT                   /product="UTP-glucose-1-phosphate uridylyltransferase"
FT                   /note="TIGRFAM: UTP-glucose-1-phosphate
FT                   uridylyltransferase; PFAM: Nucleotidyl transferase; KEGG:
FT                   rso:RSp0006 probable UTP--glucose-1-phosphate
FT                   uridylyltransferase UDP-glucose pyrophosphorylase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3786"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28902"
FT                   /db_xref="GOA:B2UH51"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH51"
FT                   /protein_id="ACD28902.1"
FT                   /translation="MNEKITKAVFPVAGLGTRFLPATKASPKEMLPIVDKPLIQYAVEE
FT                   AAAAGITEMIFITGRAKRAIEDHFDKAYELETELAAKNKQALLDMVQSIKPAGVECFYV
FT                   RQPETLGLGHAVLCAQKLVRDEPFAVILADDLLDHEPPVMQQMTELYDHYRCSIVGVET
FT                   IAPEATRSYGVVAGREWDDRLVKLDGIVEKPAPSEAPSNLGVVGRYILTPRIFDHLRNL
FT                   RPGAGGELQLTDAIQSLLAEEQILAYRYRGQRFDCGSKFGYLQATVEFALRHPEVRADF
FT                   ETYLNERLGRAPDQATPLGKSDRRLREDTIALSVAA"
     atgaacgaga agatcaccaa ggccgtgttt cccgtggcgg ggctcggtac gcgtttccta        60
     cccgccacca aggccagccc caaagagatg ttgccgatcg tcgacaagcc gctcatccaa       120
     tatgcggtgg aagaggcggc cgcggcgggc atcacggaga tgatcttcat caccgggcgc       180
     gccaagcgcg caatcgaaga ccactttgac aaggcgtacg aactcgaaac cgaactggcg       240
     gccaagaaca agcaggcgtt gctggacatg gtgcagtcaa tcaagccggc cggcgtcgag       300
     tgtttctatg tgcgccagcc cgagacgctg gggcttggcc acgcggtgtt gtgcgcgcag       360
     aaattggtac gcgacgagcc ctttgccgtg attctggcgg acgatctgct cgatcacgag       420
     ccccccgtca tgcagcagat gaccgagctg tacgaccact accgctgctc cattgtcggt       480
     gtcgagacga tcgcgccgga ggcgacgcgt tcatacggcg tcgtggcggg gcgggaatgg       540
     gatgaccggc tggtcaagct cgatggcatc gtggagaagc cggcgccaag cgaggcgccg       600
     tccaatctgg gcgtggttgg gcgctatatc ctgacgccgc gtatcttcga tcatctgcgc       660
     aacctgaggc cgggtgccgg cggcgaactg caattgaccg atgcgatcca gagccttctg       720
     gccgaagaac agatcctggc gtatcgctac cgcggtcagc gattcgactg cggcagcaag       780
     tttggctacc tgcaggcgac ggtcgagttt gcgcttcgcc atccggaagt gcgcgctgac       840
     ttcgaaacgt atctgaacga acgccttggt cgggcgcccg accaggcgac acccttgggc       900
     aagtcggacc ggcggttgcg cgaagacacc attgcgctga gtgtggcggc ctga             954
//

If you have problems or comments...

PBIL Back to PBIL home page