(data stored in ACNUC7421 zone)

EMBL: CP001069.PE264

CP001069.PE264       Location/Qualifiers
FT   CDS_pept        304279..305109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4037"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: atc:AGR_L_1202 ABC
FT                   transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4037"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29140"
FT                   /db_xref="GOA:B2UHT9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHT9"
FT                   /protein_id="ACD29140.1"
FT                   /translation="MPSSTNTMPAVGAQRTGLAHKTKIRLFQLAVVVLMFGSWEGLGRA
FT                   GVVDPFYFSMPSSIVARIWEWFTAGDIYTHLAITLAETILSFGIGTLLGISLGLWLGLS
FT                   RLAAEVLDPFIKVFNAIPRILLAPIFVMWFGLGLTSKVALGATMVLFITFFNTYQGVRE
FT                   VNPVILANARLLKASRISLLRHVYVPSATSWILSSLRASVGMAVMGAIVAEYLGSSAGL
FT                   GHLIAQAEGVFDATGVFSGIVVLSAFVIALDRSVDALEGKLLVWRPKVDPETSA"
     atgccgtcca gcactaacac gatgcctgcc gtgggcgcgc agcgcacggg tctcgcgcac        60
     aagaccaaga tccgcctgtt ccagttggcc gtagtggtgt tgatgttcgg ctcgtgggag       120
     ggccttggcc gtgcgggcgt ggtcgatccg ttctatttct cgatgccgtc gtcgatcgtc       180
     gcgcgcatct gggagtggtt taccgccggc gacatctaca cgcatctggc catcacgttg       240
     gccgagacga ttctctcgtt cggcatcggc acgttgctcg gcatcagcct ggggctgtgg       300
     ctcggcttgt ccaggctcgc ggccgaggtg ctggacccgt tcatcaaagt cttcaacgcg       360
     atcccgcgca tcctgctcgc gcccatcttc gtgatgtggt tcgggctggg gctgacctcc       420
     aaggtggcgt tgggcgcgac gatggtgctg ttcatcacct tcttcaatac gtaccagggt       480
     gtgcgcgagg tgaaccccgt catcctggcc aacgcgcggc tgctcaaggc cagccgcatc       540
     agcctgctgc gccatgtgta tgtgccgtcg gctacgagct ggattctctc cagcctgcgc       600
     gcttccgtcg gcatggctgt gatgggcgca atcgtggcgg agtacctcgg ttcgtcagcc       660
     ggcctgggcc acctgattgc gcaggccgaa ggcgtgttcg atgccaccgg cgtgttctcc       720
     ggaatcgtcg tgctgtcggc cttcgtgatt gcgctggacc gcagcgtcga tgcgctcgag       780
     ggcaagttgc tggtgtggcg cccgaaggtt gatcccgaga ccagtgcctg a                831
//

If you have problems or comments...

PBIL Back to PBIL home page