(data stored in ACNUC7421 zone)

EMBL: CP001069.PE266

CP001069.PE266       Location/Qualifiers
FT   CDS_pept        306168..306962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4039"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; KEGG: bam:Bamb_4808 transcriptional
FT                   regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4039"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29142"
FT                   /db_xref="GOA:B2UHU1"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHU1"
FT                   /protein_id="ACD29142.1"
FT                   /translation="MTAERQTTQNETTPAANEGDAATPGQSGVAALDRAFSILFAFRPG
FT                   DYALTLAELAARTGLYKSTILRLAGSLIQHRMLFRLEDGRYQIGAAPLMLGALYQRSMR
FT                   LGDVVLPHMRALAEATGEAVSLYIRERDVRVCLHRVDSNHSIRDHVREGDVLPLERGSG
FT                   GRVLCAFSGMQGATYDAIRRDHYYVSIGERDRETVGLSVPVFGAQQALRGALCLAGPAS
FT                   RIDGALLQSWRVPVLEHAAQITSTLGGDPAPLRLAAQLISKT"
     atgaccgcag agcgccaaac cacccagaac gagaccacgc ccgccgccaa cgagggcgat        60
     gccgccacgc cggggcagtc gggcgtggct gcgctggacc gcgcgttctc gatcctgttt       120
     gcgttccgcc cgggcgatta cgcgctgacg ctggctgagc tggccgcccg cactgggctc       180
     tacaagagca cgatcctgcg gctggccggc tcgctcatcc agcatcgcat gctgtttcgc       240
     ctggaagacg gccgctacca gatcggggcc gcgccgttga tgcttggcgc gctctaccag       300
     cgcagcatgc gcctgggcga cgtggtgctg ccgcacatgc gtgcgctggc cgaggccacg       360
     ggcgaggcag tgtcgctcta catccgcgag cgcgatgtgc gtgtctgcct gcaccgcgtg       420
     gattcgaacc attcgatccg cgatcacgtg cgcgagggcg atgtgctgcc gctggagcgc       480
     ggttcgggcg ggcgcgtgct gtgcgcgttt tcgggcatgc aaggcgccac ttacgacgcg       540
     atccggcgcg atcactacta cgtatcgatc ggcgagcgcg atcgggaaac ggttggcctg       600
     tcggtgccgg tgtttggtgc gcagcaggcg ctgcggggtg cgctgtgcct ggccggtccg       660
     gcgtcgcgta tcgacggggc gttgctgcaa tcgtggcgcg tgccggtgct cgagcacgcc       720
     gcgcaaatca cgtccacgct gggtggcgac cccgcaccgc tgcgtctcgc tgcccaattg       780
     atctctaaaa cctag                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page