(data stored in ACNUC7421 zone)

EMBL: CP001069.PE267

CP001069.PE267       Location/Qualifiers
FT   CDS_pept        307034..308221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4040"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: reh:H16_B2210 predicted acyl-CoA
FT                   transferase/carnitine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4040"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29143"
FT                   /db_xref="GOA:B2UHU2"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHU2"
FT                   /protein_id="ACD29143.1"
FT                   /translation="MALPLAGLRVLDLSNVLAGPFCGYQLGLLGAEVIKVEVPGNGDLA
FT                   RRLGADPEQARRKMGASFVAVNAGKQSVTVNLKHPEGRAILLKLVAQADALIENYRPGV
FT                   MDRLELGYDVLREVNPRLVYCAISGFGKDGPLSGRPAYDQIIQGISGVMSVTGDDASAP
FT                   LRVGYPISDTVGGITAALAVTACLLGAQRTGQGCMVDVSMLESTLATMGWVVSNYLNAG
FT                   VTPQPMGNQNFTAAPSGTFTTGDGLINIAANEDKQFAALCRVVGHPELATDARFAERHA
FT                   RKEHRQQLNDALEAALAARPATEWEPLLIDAGVPAGLVLDVPGVLAHEQVTGRGFVTAF
FT                   PEAGQHVTRAGFRLSGEDPCPQTPAPMLSAHTDDWLTRLGYRHDQIEALRAEGAI"
     atggctttgc ctctcgcggg tttgcgcgtg ctcgacttgt cgaacgtgct ggccgggccg        60
     ttctgcggct atcagctggg tttgctcggc gctgaagtca tcaaggtcga agtgcccggc       120
     aatggcgacc tcgcccgccg tctcggggcg gatccggagc aggcgcgccg caagatgggc       180
     gcctcgttcg tcgccgtcaa tgcgggcaag cagtccgtca ccgtcaacct gaaacacccg       240
     gaagggcgcg cgatcctgct caagctggtg gcgcaggccg atgcgctgat cgaaaactat       300
     cgccccggcg tgatggaccg cctggaactc ggctacgacg tgctgcgcga ggtgaatccg       360
     cgtcttgtct actgcgccat ctcgggcttc ggcaaggatg gcccgcttag cggcagaccg       420
     gcatacgacc agatcatcca gggcatttcc ggcgtgatga gcgtcaccgg cgacgacgca       480
     tcggcgccgc tgcgcgtggg ttacccgatc agcgatacgg tgggcggcat cacggcggcg       540
     ctggccgtca ccgcctgcct gctcggcgcg caacgcacgg ggcagggctg catggtcgat       600
     gtgtcgatgc tggaatcgac gctcgccacc atgggctggg tcgtctccaa ctatctgaac       660
     gccggcgtca cgccacagcc gatgggcaac cagaatttca ccgccgcgcc gtcgggcaca       720
     ttcaccacgg gcgatggact gatcaacatc gccgccaacg aagacaagca gtttgccgcg       780
     ctgtgccgcg tggtggggca tccggagctg gccaccgacg cgcgctttgc cgagcgccat       840
     gcacgcaagg agcatcgcca gcagctcaac gacgcgctgg aagcagcgtt ggccgcgcgc       900
     ccggccaccg aatgggaacc gctgctgatc gatgccggcg ttcctgccgg gctggtgctc       960
     gacgtgcctg gcgtgctggc gcacgaacaa gtgacgggcc gcggctttgt caccgcgttc      1020
     ccggaagcgg ggcagcacgt gacgcgcgcg gggttccgcc tctcgggcga agacccgtgc      1080
     ccgcagaccc ccgcgccaat gctctccgcc cataccgacg actggctcac caggctcggt      1140
     taccgccacg accaaatcga agccttgcgc gctgaaggcg ccatctga                   1188
//

If you have problems or comments...

PBIL Back to PBIL home page