(data stored in ACNUC7421 zone)

EMBL: CP001069.PE269

CP001069.PE269       Location/Qualifiers
FT   CDS_pept        309075..309971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4042"
FT                   /product="SMP-30/Gluconolaconase/LRE domain protein"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE domain protein;
FT                   KEGG: pol:Bpro_4512 gluconolactonase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4042"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29145"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHU4"
FT                   /protein_id="ACD29145.1"
FT                   /translation="MTYFNWPVIETTVFAEMPVALRRPVPTEWSRANKGGAPVDCFLEG
FT                   PCWDAHGNLWLVDIPHGRILRVSSQGDWDVVAEYDGEPNGLALRHDGTLLIADYKNGLL
FT                   SLDPATGAVTPFLTRRNSERFKGPNDLIVARNGDVYFTDQGQTGLHDPTGRVYRLRTDG
FT                   RLDCLLANGPSPNGLVLTPDESALFVAMTRDNAVWRLPLLADGSTSKVGRFAQFYGTSG
FT                   PDGMAMDAAGHLFVAHASLGAVFVVSPHGEPLARIASCRGRTTTNVALTPDGHSLVITE
FT                   SATGTILRARWTPPPHD"
     atgacgtatt tcaactggcc cgtcatcgaa accaccgtct ttgcggagat gccggtcgcg        60
     ttgcgtcgcc cggtgccgac cgaatggtcc cgcgccaata aaggcggcgc gccggtcgat       120
     tgctttctgg aaggcccgtg ctgggacgcg cacggcaatc tctggctggt cgacattccg       180
     catggccgca tcctgcgcgt ctcttcgcag ggcgattggg atgtggtggc ggaatacgac       240
     ggcgaaccga atggcctggc gctgcgccac gacggcacgc tgctgatcgc ggactataag       300
     aatgggttgc tgtcgctgga tcccgcgacg ggcgcggtca cgccgttcct gacccgccgc       360
     aacagcgaac gcttcaaggg ccccaacgat ctgatcgtcg ctcgtaacgg cgatgtctat       420
     ttcaccgacc aaggccagac tggcctgcac gaccccaccg gccgcgtata tcgcctgcgc       480
     acggatggcc ggctcgattg cctgctcgcc aatggcccga gccccaacgg tctggtgctc       540
     actcctgacg aatccgcgct gttcgttgcc atgacgcgcg acaacgccgt ctggcgtttg       600
     cccctgcttg ccgatggcag cacaagcaag gtgggccgct tcgcgcagtt ctacggcacc       660
     agcggccccg acggcatggc gatggacgca gccggccacc tgttcgtcgc gcatgcgtcg       720
     ctaggcgcgg tgttcgtcgt ctcgccgcac ggcgaaccgc tggcccgcat cgcgtcgtgc       780
     cgagggcgca ctaccaccaa cgttgcactc acgccagacg ggcactcgct cgtcatcact       840
     gaatccgcta cgggcaccat attgcgcgcc cgctggaccc cgccgcccca cgactga          897
//

If you have problems or comments...

PBIL Back to PBIL home page