(data stored in SCRATCH zone)

EMBL: CP001069.PE27

CP001069.PE27        Location/Qualifiers
FT   CDS_pept        29300..30646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3787"
FT                   /product="General substrate transporter"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: rso:RSp0007 putative
FT                   alpha-ketoglutarate permease transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3787"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28903"
FT                   /db_xref="GOA:B2UH52"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH52"
FT                   /protein_id="ACD28903.1"
FT                   /translation="MTQPQAGTMPGEFSPAQAPARDRDTPQDVRRRLRSIFSGSIGNLV
FT                   EWYDWYVYSAFALYFAKSFFPKGDQTAQLLNTAAVFAVGFLARPVGGWLMGIYADRYGR
FT                   KRALFFSVVLMCLGSLIIALTPSYAAIGVAAPVLLVLARLLQGLSVGGEYGTSATYLSE
FT                   VANKEHRGFYSSFQYVTLIAGQLTALALLIVLQQFVLSPAQLDAWGWRIPFFVGALCAL
FT                   VAMRMRSHMEETQSFTAAKENKKRGTLAELAKHPRAVAIVVGLTLGGTVAFYTYSIYMQ
FT                   KFLANTVGLSKSQATLVSGATLLLFALLQPIVGGLSDRIGRRPILIAFGVLGTLLTVPI
FT                   MTGISHTTNPWSAFFLIMAALVIVSGYTSINAVVKAELFPAEVRALGVGLPYALTVSIF
FT                   GGTAEYIALWLKQAGHESLFYWYVTGTIFLSLLVYVFMRDTREHSRIEH"
     atgacacagc cccaagctgg cacgatgccg ggcgaattct cgcccgccca agcccccgcc        60
     agagacagag acactccgca agacgttcgt cgtcgtctgc gttccatctt ctcgggctcg       120
     atcggcaacc tcgtcgagtg gtacgactgg tacgtgtatt cggcgtttgc gctgtatttc       180
     gccaagtcgt ttttcccgaa gggcgatcag accgcgcagt tgctcaacac agccgcggtg       240
     tttgccgtcg gtttcctggc gcggccggtg ggcggctggt tgatgggcat ttatgccgat       300
     cgctatggcc gcaagcgcgc gctgttcttc tccgtggtgc tgatgtgcct gggctcgctg       360
     atcattgccc tgacgcccag ctatgcggcc atcggcgtcg cggcgccggt gctgctggtg       420
     ctggcgcgcc tgctgcaggg gttgtcggtc ggcggggagt acggcacatc ggccacgtac       480
     ctcagcgagg tcgccaacaa ggaacatcgc ggcttctatt ccagcttcca atacgtcacg       540
     ctcatcgccg gccagctgac ggcgctggcg ctgctgatcg tgctgcagca gttcgtgctg       600
     tcaccggcgc agctggacgc atggggctgg cgcattccat tcttcgttgg tgcactgtgc       660
     gcgctggtgg cgatgcgcat gcgttcgcac atggaggaaa cgcagtcatt cacggctgcg       720
     aaagagaata agaaacgcgg cacgctggcc gaactcgcca agcatccgcg cgcggtggcc       780
     atcgtcgtgg gcctgacgct gggcgggacg gttgcgttct acacgtactc gatctacatg       840
     cagaagttcc tggcgaacac ggtgggcctg tcgaagagcc aggcaacgct ggtgtcaggc       900
     gcgacgctgc tgctcttcgc gctcctgcag cccatcgtgg gcgggttgtc cgaccgtatc       960
     ggccgtcgcc cgatcctgat cgcgttcggc gtgctgggta cgctcttgac ggtgcctatc      1020
     atgaccggca tcagtcacac gacgaacccg tggtcagcct ttttcctcat catggccgcg      1080
     ctggtgatcg tttccggcta cacgtcgatc aacgcggtgg tgaaggccga actgttcccg      1140
     gcagaggtgc gtgcgctggg cgtggggctg ccgtatgcgc tcacggtgtc gatcttcggc      1200
     ggcacggcgg agtacatcgc actgtggctc aagcaggcgg gccacgagtc gctgttctac      1260
     tggtatgtga cgggcaccat cttcctgtcg ctgttggtct acgtgttcat gcgcgatact      1320
     cgcgagcatt cccgtatcga acactga                                          1347
//

If you have problems or comments...

PBIL Back to PBIL home page