(data stored in SCRATCH zone)

EMBL: CP001069.PE273

CP001069.PE273       Location/Qualifiers
FT   CDS_pept        313389..314336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4046"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: rso:RSp1410
FT                   flagellar motor protein MotB"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4046"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29149"
FT                   /db_xref="GOA:B2UHU8"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHU8"
FT                   /protein_id="ACD29149.1"
FT                   /translation="MSKSSTPTFIVIRRNKKGGHGHHGGAWKIAYADFVTAMMAFFLLM
FT                   WLLSSVTKAELSSVETYFRTPLKVALFGGAGSGDQSSILQGSPALKQNMPQPNPSPSPT
FT                   VQRQRNIRDESDDAALNKLKQKIAEMVETNPVMSQFKHQLLIDMTTEGLRIQIVDQQNR
FT                   PMFANASAEVQPYMRTILRELGTALNDVPNPISLSGHTDATQYATQHGYSNWELSADRA
FT                   NASRRELVAGGMKPEKVSRVVGLEASVPLDKTNIYNPINRRISIVVLNARAAEAVRSGG
FT                   VEPVADLRNDGKDTLTDAAARATGVADAVTAAKP"
     atgagcaagt ccagcacgcc gaccttcatt gtcattcggc gcaacaagaa aggcggacac        60
     ggccaccacg gtggcgcgtg gaagatcgcc tacgccgact tcgtgaccgc catgatggcg       120
     ttcttcctgc tgatgtggct gctcagctcg gtgaccaagg ccgagctgtc gtcggttgaa       180
     acgtatttcc gcacgccgct gaaggtggcg ctgttcggtg gcgccgggtc gggcgaccag       240
     tcgagcatcc tgcagggcag cccggcgctc aagcagaaca tgccgcagcc gaacccgagt       300
     cccagcccga cggtgcagcg ccagcgcaac atccgcgatg aatcggacga tgcggcgctg       360
     aacaagctca agcagaagat tgccgagatg gtcgagacga acccggtgat gagccagttc       420
     aagcaccagt tgctgatcga catgaccacc gaaggcctgc gcatccagat cgtcgaccag       480
     cagaaccgcc cgatgtttgc caacgccagc gccgaggtgc agccgtacat gcgcaccatc       540
     ctgcgcgagc tgggcacggc gctgaacgat gtgcccaacc cgatcagcct gtcgggccac       600
     accgacgcca cgcagtacgc cacgcagcac ggctacagca actgggaact gtcggccgac       660
     cgcgccaacg catcgcgacg cgagctggtg gcgggcggca tgaagcccga gaaggtcagc       720
     cgcgtggtgg gcctggaggc atcggtgccg ctggacaaga cgaacatcta caacccgatc       780
     aatcgccgca tcagcatcgt cgtgctcaac gcgcgcgccg ccgaggctgt gcgctcgggt       840
     ggggtcgagc cggtggccga cctgcgcaat gacggcaaag acacgctgac cgacgccgcc       900
     gcacgtgcca cgggtgtggc agacgcggtg actgcggcca agccataa                    948
//

If you have problems or comments...

PBIL Back to PBIL home page