(data stored in SCRATCH zone)

EMBL: CP001069.PE274

CP001069.PE274       Location/Qualifiers
FT   CDS_pept        314362..314775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4047"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG: rso:RSp1409
FT                   putative chemotaxis response regulator transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4047"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29150"
FT                   /db_xref="GOA:B2UHU9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHU9"
FT                   /protein_id="ACD29150.1"
FT                   /translation="MSEKHILVVDDSTSIRRMIAACLRECGFAVTEAGDGSAALEAVRT
FT                   SAQGSHHLVITDQVMPSMDGLTLIRALRALPAYADTPILMLTTEADNSIRDQARAAGAT
FT                   GFLPKPFDPDGLTDSVMQLLEWHAQTHGSASTH"
     atgagcgaga aacacatcct ggtggtggac gattccacgt cgatccgccg catgattgcc        60
     gcgtgcctgc gcgagtgcgg ctttgccgtg acggaagccg gcgacggctc cgccgcgctg       120
     gaggccgtgc gcacgagtgc gcagggcagc caccaccttg tgatcactga ccaggtgatg       180
     ccgtcgatgg acggcctgac cctcatccgc gcgctgcgcg cactgccggc ctacgccgac       240
     accccgatcc tcatgctgac caccgaggca gacaactcca tccgcgacca ggcacgtgct       300
     gccggcgcga cgggcttcct gcccaagccg ttcgacccgg atgggctgac ggattcggtg       360
     atgcagttgc tcgaatggca tgcgcagacc cacgggtctg catcgacgca ttaa             414
//

If you have problems or comments...

PBIL Back to PBIL home page