(data stored in ACNUC7421 zone)

EMBL: CP001069.PE276

CP001069.PE276       Location/Qualifiers
FT   CDS_pept        317049..317540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4049"
FT                   /product="CheW protein"
FT                   /note="PFAM: CheW domain protein; KEGG: rso:RSp1407
FT                   probable chemotaxis protein CheW"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4049"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29152"
FT                   /db_xref="GOA:B2UHV1"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHV1"
FT                   /protein_id="ACD29152.1"
FT                   /translation="MEVKKHAIGDDTGGEEYLAFTLGREEYGIDILKVQEIRGYETVTR
FT                   IANAPDFIKGVINLRGIIVPIVDLRIKFQLDRVEYNQYTVVIILNLMDRVVGIVVDGVS
FT                   DVLTLQSQQIKPAPEFSGALDTEYIRGLGSIDERMLILVDIERLLLSADMALCDEAEAA
FT                   "
     atggaagtca agaaacacgc gatcggcgac gacaccggcg gggaggagta cctggccttc        60
     acgctgggtc gcgaggaata cggcatcgat atcctgaagg tgcaggagat ccgcggctac       120
     gagaccgtca cgcgcattgc caatgcaccc gacttcatca agggtgtgat caacctgcgc       180
     ggcatcatcg tgccgatcgt tgatctgcgc atcaagttcc agctcgatcg tgtcgaatac       240
     aaccagtaca ccgtcgtgat catcctgaac ctgatggacc gcgtggtcgg catcgtggtg       300
     gatggcgtgt cggacgtgct gacgctgcaa agccagcaga tcaagccagc gccggagttc       360
     tcgggcgcgc tggacacgga gtacatccgt ggcctgggct cgatcgacga gcgcatgctg       420
     attctggtgg acatcgagcg cctgctgctg tcggccgaca tggctctgtg tgacgaagct       480
     gaagccgcct ga                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page