(data stored in ACNUC7421 zone)

EMBL: CP001069.PE278

CP001069.PE278       Location/Qualifiers
FT   CDS_pept        319736..321640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4051"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: reu:Reut_B5602
FT                   histidine kinase, HAMP region:bacterial chemotaxis sensory
FT                   transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4051"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29154"
FT                   /db_xref="GOA:B2UHV3"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHV3"
FT                   /protein_id="ACD29154.1"
FT                   /translation="MGWIKRLPVSTVLTGGFLIVAAMGAAIGGLGIYTITQLTKASEEL
FT                   AQKQMRAITQMGSAANSLAHASRAQTALLIATTLTERKTLSTQIADSMQHLKDGVENVR
FT                   PLFTSDEGKKMIREVDAIYPVWGKRMTDFVALMDKQGLDPTQFDSRVTAENVGLLDDTA
FT                   AFEKTLDKMVKRVEEVSAASTVKARDDAHRSRLVMMVMACAGALLGIVLGLVIARRLSR
FT                   QLGGEPSYAAEIARRIAAGDLAVHVQTRPGDHGSMLFAMAQMQQQLTGTITNIKSSADS
FT                   IASATKQIAAGNADLSQRTEEQASSLEETASSMEELTSIVKQNADNARQASQLAGSASD
FT                   IAVKGGEVVGRVVETMAGINASSKKIADIIGVIEGIAFQTNILALNAAVEAARAGEQGR
FT                   GFAVVAGEVRSLAQRSATAAKEIKELIGDSVGRVRNGSALVAEAGTVIEEVVVAVRRVT
FT                   DIMGEISAASDEQSSGIEQVNQAVNQMDEVTQQNAALVEQAAAAALSLEEQAQLLRNAV
FT                   ATFRTDASAELAVAAPIAVAAPAVPGEARPHKTEVVPSVARALASRKAAKPAVLPEAAP
FT                   EQVAGPAAEQGEKAPHDAHAPIVPVAAAVVSAAASEAVVAPALKLTTGSADEDDWSTF"
     atgggttgga tcaagcgttt gccggtgtcc acggtactca ccggtggttt tctgatcgtg        60
     gcggccatgg gcgcagccat tggcgggttg ggcatctata cgatcacgca gttgacaaag       120
     gccagcgaag agctggcgca aaagcagatg cgcgccatca cgcagatggg cagcgcggcc       180
     aacagcctgg cacacgccag ccgtgcgcag accgcattgc tgattgccac cacgctcacc       240
     gagcgcaaga cgctcagcac gcagattgcc gacagcatgc agcacctcaa agacggggtg       300
     gagaacgtgc gcccgctgtt cacgtcggac gaaggcaaga agatgatccg cgaggtcgat       360
     gcgatctacc ccgtctgggg caagcgcatg accgatttcg ttgcgctgat ggacaagcag       420
     ggcctggacc cgacccagtt cgacagccgc gtcacggccg agaacgtcgg cctgctggac       480
     gacaccgccg cgtttgaaaa gacgctcgac aagatggtca agcgtgtgga agaggtctct       540
     gccgcgtcca ccgtcaaggc ccgtgacgat gcacaccgct cgcgcctggt gatgatggtg       600
     atggcctgtg caggtgcgct gctcggcatc gtgctgggcc tggtcattgc gcgccggctg       660
     tcgcgccagt tgggcggtga gccttcgtac gcggccgaga tcgcgcgccg cattgccgcc       720
     ggcgatctgg ccgtgcacgt gcagacccgc cccggcgacc atggcagcat gctcttcgcc       780
     atggcgcaga tgcagcagca actgaccggc acgatcacca acatcaagag ttccgccgat       840
     tccattgcca gcgccaccaa gcagatcgcg gccggcaacg cagacttgtc gcagcgcacg       900
     gaagagcagg cctcgtcgct ggaggaaacc gcttccagca tggaagagct gaccagcatc       960
     gtgaagcaga acgccgacaa cgcccgccag gccagccagt tggccggcag cgcgtcggac      1020
     atcgccgtca agggcggcga agtggtgggc cgcgtggtcg aaaccatggc cggcatcaac      1080
     gccagcagca agaagatcgc cgacatcatc ggcgtgatcg aaggcattgc cttccagacc      1140
     aacatcctcg ccctgaatgc agcggtggaa gccgcgcgcg cgggcgaaca gggacgcggt      1200
     tttgcagtgg tggccggcga ggtgcgcagc ctcgcgcagc gctcggccac ggcggccaag      1260
     gaaatcaagg agctgatcgg cgattccgtt ggccgtgtgc gcaacgggtc ggccctggtg      1320
     gccgaagccg gcacggtgat cgaggaggtg gtagtggccg tgcgccgggt gaccgacatc      1380
     atgggcgaga tttccgccgc gtcggacgaa caaagctccg gcatcgaaca ggtcaaccag      1440
     gccgtgaacc agatggacga ggtcacgcag cagaacgccg cgctggtgga gcaagccgcc      1500
     gccgccgccc tgtcgctgga agaacaggcg caactgctgc gcaatgcagt ggcaacgttc      1560
     cgcaccgatg cctcggccga gttggccgtg gcggcgccga ttgccgttgc ggcgccagcc      1620
     gtgcccggcg aagcccgccc ccacaagacc gaagtggtgc cctctgttgc gcgcgccttg      1680
     gcgtcgcgca aagccgccaa gccggccgtg ttaccggagg ctgcccccga gcaggttgcc      1740
     ggcccggctg ccgagcaagg agaaaaagcg cctcacgatg cacatgcacc gattgtgccg      1800
     gtggctgccg ccgtcgtttc ggcagccgct tcggaggccg tcgtcgcccc ggccctcaag      1860
     ctgaccaccg gttctgccga tgaagatgac tggagcacct tctga                      1905
//

If you have problems or comments...

PBIL Back to PBIL home page