(data stored in SCRATCH zone)

EMBL: CP001069.PE279

CP001069.PE279       Location/Qualifiers
FT   CDS_pept        321744..322625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4052"
FT                   /product="MCP methyltransferase, CheR-type"
FT                   /EC_number="2.1.1.80"
FT                   /note="PFAM: MCP methyltransferase CheR-type; KEGG:
FT                   rso:RSp1405 probable chemotaxis protein methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4052"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29155"
FT                   /db_xref="GOA:B2UHV4"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR026024"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHV4"
FT                   /protein_id="ACD29155.1"
FT                   /translation="MAAQNLAPVSPTLASREFSFTAEDFGRIRDLIYRRVGISLSDRKS
FT                   EMVYSRLARRLRVVNLGSFRDYLDALEKGHLPDEWEAFTNALTTNLTAFFREQHHFPIL
FT                   HEHAKAKRTPFTVWCSASSTGEEPYSIAITLAEAFGSMSPSQVSVIASDVDTNALARAR
FT                   AGIYPMERVAALSPERLKKYFLRGTGKHEGYARVRPELQAMIDFRQINLLDRDWPLQQK
FT                   FDVIFCRNVMIYFDKPTQAKILEHFIDVMKPDGLLFAGHSESFLQVTKAWSLRGKTVYE
FT                   IAPELRARMGAR"
     atggcagcac aaaacttggc gccagtttcg ccgacgctcg cgtcgcgcga gttttcattc        60
     accgccgaag atttcggccg catccgcgac ctgatctacc ggcgcgtcgg catctcgctg       120
     tccgaccgca agagtgaaat ggtctatagc cggctggccc gccgcctgcg tgtggtcaac       180
     ctcggttcgt tccgcgacta cctcgatgca ctggaaaaag gccacctgcc cgacgagtgg       240
     gaggccttta ccaacgcgct gaccaccaac ctcaccgcgt tcttccgcga gcagcatcac       300
     ttcccgatcc tgcacgagca cgccaaggcc aagcgcacgc cgttcaccgt gtggtgttcg       360
     gcatcgtcga ccggcgaaga gccgtactcg atcgccatca cgctggccga agcctttggc       420
     tcgatgtcgc ccagccaggt gagcgtgatt gcctcggatg tggataccaa cgcgctggcc       480
     cgcgcccgcg ccggcatcta tccgatggag cgtgtcgcgg ccctgtcgcc cgagcgcctg       540
     aaaaagtatt tcctgcgcgg caccggcaag cacgaaggct atgcccgcgt gcggcccgag       600
     ttgcaggcca tgatcgactt tcgccagatc aacctgctcg accgcgattg gccgttgcag       660
     cagaagttcg acgtgatctt ctgccgcaac gtgatgatct atttcgacaa gcccacgcag       720
     gccaagattc ttgagcattt catcgacgtg atgaaacccg atggcctgct gtttgccggc       780
     cattcggaga gcttcctgca ggtcaccaag gcgtggtcgc tgcgcggcaa gaccgtgtac       840
     gagatcgccc ccgagctgcg cgccaggatg ggggcacgat ga                          882
//

If you have problems or comments...

PBIL Back to PBIL home page