(data stored in ACNUC7421 zone)

EMBL: CP001069.PE284

CP001069.PE284       Location/Qualifiers
FT   CDS_pept        complement(325778..326818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4057"
FT                   /product="ApbE family lipoprotein"
FT                   /note="PFAM: ApbE family lipoprotein; KEGG: rso:RSp1366
FT                   probable thiamine biosynthesis ApbE transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4057"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29160"
FT                   /db_xref="GOA:B2UHV9"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHV9"
FT                   /protein_id="ACD29160.1"
FT                   /translation="MHPLPPSNLGRRRCLAGVPLLAVGMFVRPALADPTVERASTQLLG
FT                   TQIDIIAQDARPGAAGAAMRAAFVEMARLECLMSRYRPDSQVSALARAAGRNPVPVAPE
FT                   VMSVFKLARQVSEQSRGAFDITVGAYSGWNFDPEHSRIPSSSELARERRFVNYRDVVLD
FT                   ERHGSVYLRRPGMRLDLGGIAKLPILEAGMRVLRQHGIRDAMINGGGDVVASGKLQGHE
FT                   WRVGLRDPLAPERLLGVVTLSDGVVASSGDYERYFMHNGQRFHHVLDPETGLPAHGPHG
FT                   VTLVSRDVDDVNGLGAAIMAAGTATGQRMLAPMLARVDALIVGSGVRPWMSAGMATRLR
FT                   QFSASS"
     atgcatccgc tgcccccttc caacctgggc cgccggcgct gcctggcggg ggtgcccctg        60
     ctggcagtcg gcatgttcgt acggccggcc ctggcagacc ccactgtgga gcgcgcatcc       120
     actcaattgc tgggcactca aatcgacatc attgcgcaag acgcgagacc gggcgccgcc       180
     ggtgcggcca tgcgcgctgc ctttgtggag atggcgcggc tcgaatgctt gatgagccgc       240
     taccggcccg acagccaggt cagcgcactg gcacgcgcgg cggggcggaa ccccgtgccg       300
     gtggcacctg aagtcatgtc ggtgttcaag cttgcccgac aggtctcgga gcaaagccgc       360
     ggcgccttcg atatcaccgt cggcgcgtac tccggctgga attttgatcc ggagcacagc       420
     cgcattccga gcagcagcga actggcgcgt gagcgccgct tcgtcaacta tcgagacgtc       480
     gttctggacg agcgccacgg cagcgtctac ttgcgacgcc cggggatgag gctggatctt       540
     ggcggcattg ccaagctgcc gatcctggag gcaggcatgc gcgtgctacg gcaacacggc       600
     atacgcgatg ccatgatcaa cggtggaggc gatgtggtgg ccagcgggaa gctgcaaggt       660
     cacgaatggc gcgtcggact gcgcgatccg cttgcgccgg agcgactgct gggcgtggtc       720
     acgctcagtg acggggttgt ggcgtcatcc ggagactacg agcgttactt catgcacaac       780
     ggtcagcgct ttcatcacgt tctcgatccg gaaacgggtc tgcctgcgca tgggccccat       840
     ggcgtaaccc tggtcagtcg cgacgttgac gacgtcaacg gccttggcgc ggcaatcatg       900
     gcagcgggca ccgccaccgg gcagcggatg cttgcaccga tgctcgcacg cgtggatgcc       960
     ctgatcgtag gttctggagt tcggccatgg atgtcggccg gaatggcaac gcgcttgcgg      1020
     cagttctctg caagcagttg a                                                1041
//

If you have problems or comments...

PBIL Back to PBIL home page