(data stored in SCRATCH zone)

EMBL: CP001069.PE288

CP001069.PE288       Location/Qualifiers
FT   CDS_pept        332112..333407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4061"
FT                   /product="periplasmic copper-binding"
FT                   /note="PFAM: periplasmic copper-binding; SMART: Parallel
FT                   beta-helix repeat; Carbohydrate-binding and sugar
FT                   hydrolysis; KEGG: rso:RSp1370 probable copper-binding
FT                   periplasmic NosD signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4061"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29164"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR006633"
FT                   /db_xref="InterPro:IPR007742"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR022441"
FT                   /db_xref="InterPro:IPR026464"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHW3"
FT                   /protein_id="ACD29164.1"
FT                   /translation="MRWLPVLLVVCGWLAAVQGAHASAATTVRVAAGQSLQAAIDAAHP
FT                   GDVLEIERGTYTGNLIVNKPLTLRGLDRPTLSGGQRGDTIRIGAPDVVIEGLIVRDSGD
FT                   SLKEQNAGINILPGAHRAVVRQCELTYNLFGLWIEKANDVRIEANTITGKRDYNSAQRG
FT                   NGVELYNTQGARIIGNNISFVRDALYVDVSHHAVFKGNRLHHSRYGTHYMNSYYNLWED
FT                   NDSYANRGGLALMEVRDQIVRNNRTWGNADHGIMLRTLQDSVVENNVVADNDRGFFIYD
FT                   VEYTQLRGNLIVGNQVGVHLSAGSTRNVVQGNDFIGNREQVRYVGARDEAWGARTAAER
FT                   AQGNFWSDYLGWDRDGDGIGDVPYEANDVVDRLIWRHPGVQLLLASPAVQALRFVSRQF
FT                   PILRVPSVVDAYPRMQPANPHWSTWRDRSPSR"
     atgaggtggc tgccggtgtt gctcgttgtc tgcggctggc ttgcggctgt gcagggcgct        60
     cacgcatcgg cggccaccac ggtgcgcgtt gcggcggggc agtcgctgca agcagccatc       120
     gacgcagcac atccgggcga tgtgcttgag atcgagcgcg gcacgtatac cggcaacctc       180
     atcgtcaaca agcctctgac gctgcgcgga ctcgatcgtc ccacgctcag cggcggccag       240
     cgcggcgaca cgatccgcat cggcgcaccg gacgtcgtga tcgagggcct gatcgttcgc       300
     gattcgggcg acagcctgaa agagcagaac gcaggcatca acatcctgcc cggcgcgcat       360
     cgcgccgtgg tgcgccagtg tgagctgacc tacaacctgt tcggtctgtg gatcgagaaa       420
     gccaacgacg tgcgcatcga ggccaacacc atcaccggca agcgtgacta caactcggcg       480
     cagcgcggca atggcgtgga gctgtacaac acgcaaggcg cgcgcatcat cggcaacaac       540
     atcagcttcg tacgggatgc gctttacgtg gacgtgtcgc accacgccgt tttcaaaggc       600
     aatcggctcc accacagccg ctatggcacg cactacatga actcctacta caacctgtgg       660
     gaggacaacg acagctatgc caaccggggc ggcctggcct tgatggaggt gcgcgaccag       720
     atcgtgcgca acaaccgcac ctggggcaat gccgaccacg ggatcatgct gcgcacgttg       780
     caggactcgg tggtggagaa caacgtggtg gccgacaacg accgcggctt cttcatctac       840
     gacgtggaat acacgcaact gcgcggcaac ctcatcgtcg gcaaccaggt gggcgtgcac       900
     ctgtcggcag gctcgacacg caacgtcgtg caaggcaacg acttcatcgg caaccgagag       960
     caagtccgct acgtgggcgc gcgtgacgag gcatgggggg cacgcacggc tgccgagcgc      1020
     gcgcagggca acttctggag cgactacctg ggctgggacc gcgatggcga tggcatcggc      1080
     gatgtgccct acgaggccaa cgacgttgtc gaccggctga tctggcgtca ccccggcgtg      1140
     caactgctgt tggcgagccc ggcggtgcag gcacttagat tcgtcagccg gcagtttccc      1200
     atcctgcgtg tgccgagcgt ggtggacgcg tatccgcgca tgcaacccgc gaacccacat      1260
     tggagcacct ggcgtgacag atccccttca cgttga                                1296
//

If you have problems or comments...

PBIL Back to PBIL home page