(data stored in ACNUC7421 zone)

EMBL: CP001069.PE290

CP001069.PE290       Location/Qualifiers
FT   CDS_pept        334338..335162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4063"
FT                   /product="putative NosY transmembrane protein"
FT                   /note="KEGG: rso:RSp1372 probable NosY transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4063"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29166"
FT                   /db_xref="GOA:B2UHW5"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHW5"
FT                   /protein_id="ACD29166.1"
FT                   /translation="MIGIEYRQVAAVAAKELRDRLRNRWVLAVAVVFAVFSLVISYFGG
FT                   AEQGTLGPRSIEFVITSLVSLVIYLIPLIALLLGFDAVVGERERGSLDLLLALPLTRVE
FT                   LLLGKYLGLAAALTLSTLGGFALMAVLLWHQFGSAGLYQAAGFVLSSVLLGLVFLSLAL
FT                   FVSVVSRERTRASGAAIALWFGFVLIFDLLLLGLLVATGGSFGGQALAYLLLLNPTDIF
FT                   RILNVFSLDQLRGLHGLVSIVPPALGNPWAMGAAMLAWIAAPLALAAWRFRA"
     atgatcggca tcgaatatcg gcaagtggcc gccgtggcgg ccaaagaact gcgcgatcgc        60
     ctgcgcaacc gatgggtgct cgcagtggcc gtcgtcttcg ccgtgttctc gctcgtgatc       120
     agctactttg gcggcgccga gcagggcacg ctcgggccgc ggtccatcga gttcgtcatt       180
     accagcttgg tcagcctcgt catctacctg atcccgctga ttgcgctgtt gcttgggttc       240
     gatgccgttg tgggcgagcg cgagcgcggc tcgctcgatc tgctgctggc cctcccgctg       300
     acgcgcgtgg aactgctgct gggcaaatac ctcgggctcg ccgcagcgct caccctgtcg       360
     acgttgggtg gcttcgcgct gatggccgtg ctcctgtggc accagttcgg ctcggcgggg       420
     ctgtatcagg cggctggctt cgtgctgagt tcggtgctgc tggggctggt ctttctgagc       480
     ctggcgctgt tcgtctctgt cgtcagccgt gagcgcacgc gtgcttcggg cgccgccatc       540
     gcgctgtggt ttggcttcgt gctgatattc gacctgttgc tgctcggcct gctcgtcgcc       600
     accggcggca gctttggtgg ccaggcgctg gcgtatctgc tgctgctcaa tcccaccgat       660
     atttttcgca tcctcaacgt gttttcgctg gaccagctgc ggggcttgca tggcctcgtc       720
     agcatcgtgc cgcctgccct gggcaacccg tgggcgatgg gcgcggcgat gctggcttgg       780
     attgccgcgc cgctggcact ggccgcctgg agattccgcg catga                       825
//

If you have problems or comments...

PBIL Back to PBIL home page