(data stored in SCRATCH zone)

EMBL: CP001069.PE292

CP001069.PE292       Location/Qualifiers
FT   CDS_pept        335692..336294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4065"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_4911 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4065"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29168"
FT                   /db_xref="InterPro:IPR008719"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHW7"
FT                   /protein_id="ACD29168.1"
FT                   /translation="MRLRRSGLMTVALLAASLWWYGVYASRRVEPEIPTEICFVAAPTP
FT                   YDPRSGTAPDAPRAIPLNARCPVCGAFPSRAPDWAAQVIFADGDAYFFDSPLSLFIYLR
FT                   NLPRYAAGRKSADIAAAYVRAVGDGRWIAALQAVYVWGSDVPGPMRRGNLPAFRNHTDA
FT                   RDFITRHGGSVTGSAGITAERLRALEPSQPHPAGRHT"
     atgcggctgc gtcgatcggg cttgatgaca gtcgctttgc tggcggcctc gctctggtgg        60
     tatggcgtgt atgcgagccg ccgggtggag cccgagattc ccaccgaaat ctgcttcgtt       120
     gcggcgccaa cgccctatga cccgcgctcg ggcacggcgc ccgatgcgcc gcgcgccatc       180
     ccgctcaacg cacgctgccc ggtctgcggc gcgtttccgt cgcgcgcgcc ggattgggca       240
     gcccaggtga tctttgccga tggcgacgcg tacttcttcg actcgccatt gagcctgttc       300
     atctacttgc gcaacctgcc gcgctacgcc gctggccgga aatcggccga cattgccgcc       360
     gcctacgtgc gtgcagttgg cgacgggcgc tggattgccg cgctgcaggc cgtctacgta       420
     tgggggtccg acgtgccggg gccaatgcgc aggggcaatc tccctgcctt ccggaatcac       480
     acggatgcgc gcgatttcat tacgcgccac ggcggatcag tcacgggctc cgccggcatt       540
     accgcagaac gcctccgggc gttggaaccc tcgcagcccc atccggcagg tcggcacacc       600
     tag                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page