(data stored in ACNUC7421 zone)

EMBL: CP001069.PE294

CP001069.PE294       Location/Qualifiers
FT   CDS_pept        337945..340071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4067"
FT                   /product="flagellar biosynthesis protein FlhA"
FT                   /note="TIGRFAM: flagellar biosynthesis protein FlhA; PFAM:
FT                   type III secretion FHIPEP protein; KEGG: rso:RSp1393
FT                   probable flagellar biosynthesis FlhA transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4067"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29170"
FT                   /db_xref="GOA:B2UHW9"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006301"
FT                   /db_xref="InterPro:IPR025505"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHW9"
FT                   /protein_id="ACD29170.1"
FT                   /translation="MNAALLRVTDILRKGDYRSAAGPVLIILILAMMVLPLPPFILDLL
FT                   FTFNIALSIIVLLISMHTLKPLDFSSFPSILLITTLMRLSLNVASTRVVLMEGHTGPDA
FT                   AGKVIEAFGHFLVGGNYTVGIVLFVILVIINFMVISKGAGRIAEVSARFTLDAMPGKQM
FT                   AIDADLNAGLIREDEARRRRTEIAQEAEFFGSMDGASKFVRGDSVAGIAILLINIVGGL
FT                   AVGVLQHGMDVGHAATNYTLLTIGDGLVAQIPALVISTAAGIMVSRVSTDKDVGQQLSS
FT                   ELFAMPTVLMTTAGVLGLLGLVPGMPHFPFILFGGGLGYLGWYLKKKREVPEIEPVLQA
FT                   IAPVDTPEASWDDVSWVDVLGLEIGYRLIPLVDKSQDGELLRRIKGIRKKFTQDMGFLA
FT                   PVVHIRDNLELGPSSYRITLKGVEIGHGEVQQGKFLAINPGGQDGMGGHGGMGGLGGRL
FT                   GTQLPGTPTVDPTFGLPAMWITADVRDRAQAEGYTVVDCSTVIATHVNQLIYTHSTELL
FT                   GRLEVQQLLDHLGKEAPKLVEDVVPKLLPVATVQKVLQNLLDEGLHIRDIRTIVETLAE
FT                   HGGRTQDPAELTAAVRVALGRAIAQQLFPNKTEMQVVTLDPNLENILLQSVVGSNAGPI
FT                   EPQLADSLMQAAADSSRQHEQMGQTGVLLVPPALRPMLARLFKRAAPSLRVLSHAEIPD
FT                   HRTIKVVAMLGGRA"
     atgaacgccg cactgctccg agtcaccgac atcctgcgca agggcgacta ccgctccgcc        60
     gcgggcccgg tgctcatcat cctgatcctg gcgatgatgg tgctgccatt gccgccgttc       120
     atcctggacc tgctgttcac cttcaacatc gcgctgtcga tcatcgtgct gctgatcagc       180
     atgcacacgc tcaagccgct ggatttctcg tcgttcccga gcatcctgct gatcaccacg       240
     ctgatgcggc tgtcgctgaa cgtggcgtcc acgcgtgtag tgctgatgga aggccacacc       300
     ggccccgacg ccgccggcaa ggtgatcgag gcgtttggcc acttcctcgt gggcggcaac       360
     tacaccgtcg gcatcgtgct gttcgtcatc ctggtgatca tcaacttcat ggtgatcagc       420
     aagggcgcgg gccggatcgc cgaggtcagc gcgcgcttca cgctcgatgc gatgcccggt       480
     aagcagatgg ccatcgacgc cgacctgaac gccggcctca tccgtgaaga cgaagcccgc       540
     aggcgccgca cggagatcgc ccaggaagcc gaattcttcg gctccatgga cggtgccagc       600
     aagttcgtgc gcggcgactc ggtggcgggt atcgccatcc tgttgatcaa catcgtcggc       660
     ggcctggcgg tgggcgtgct ccagcacggc atggacgtgg gccacgcggc caccaactac       720
     acgctgctga ccatcggcga cggcctggtc gcgcagattc ccgcgctggt gatctccacc       780
     gcggcgggca tcatggtcag ccgcgtctcc accgacaagg acgtcggcca gcaactgtcg       840
     agcgagctgt ttgccatgcc gacggtgctg atgaccaccg ccggcgtgct gggcctgctg       900
     ggcctggtgc cgggcatgcc gcacttcccg ttcatcctgt ttgggggcgg ccttggctat       960
     ctgggctggt acctgaagaa gaagcgcgaa gtgcccgaga tcgagcccgt gctgcaggcc      1020
     attgccccgg tggatacgcc cgaagcgagc tgggacgacg tgtcgtgggt cgacgtgctg      1080
     ggcctggaaa tcggttaccg cttgatcccg ctggtcgaca agagccagga cggcgagctg      1140
     ctgcgccgca tcaagggcat ccgcaagaaa ttcacgcagg acatgggctt cctggcgccg      1200
     gtggtgcata tccgcgacaa cctggagctg ggcccatcgt cgtaccgcat cacgctcaag      1260
     ggcgtggaga tcggccacgg cgaggtgcag cagggcaagt tcctggccat caatccgggc      1320
     ggccaggatg gcatgggcgg tcatggcggc atgggtggcc tcggtggtcg actgggcacg      1380
     caactgcccg gcacgcccac cgtggacccg acctttggcc tgccggccat gtggatcacc      1440
     gccgatgtgc gcgatcgcgc gcaggccgag ggctacaccg tggtcgattg cagcaccgtc      1500
     atcgccaccc acgtcaatca gttgatttac acccatagca ccgagcttct cggccgtttg      1560
     gaagtccagc agttgctcga tcatttgggc aaggaagcac cgaagctggt cgaagacgtt      1620
     gtacccaagc tgttgcccgt cgcgaccgtg cagaaggtgc tgcagaacct gctggacgaa      1680
     ggcctgcata tccgcgatat ccgcaccatc gtcgagacgc tggcggaaca cggaggcagg      1740
     acgcaagacc ccgccgaact caccgccgcc gtgcgtgtgg cgctgggccg ggcgattgcc      1800
     cagcagctct tcccgaacaa gaccgaaatg caggtcgtca cgcttgaccc gaatctggag      1860
     aacatcttgc tgcaaagcgt cgttggctct aacgccggcc cgatcgaacc gcaactggcc      1920
     gactcgctca tgcaggcggc agcggactcg tcgcggcagc acgaacagat gggtcagacg      1980
     ggcgtcctgc tcgtgccgcc cgcactgcgc ccgatgcttg cccgcctgtt caagcgtgcc      2040
     gcaccgagcc tgcgcgtgct gtcgcacgca gaaattccgg atcaccgaac gattaaggtt      2100
     gtcgccatgc ttggaggccg cgcatga                                          2127
//

If you have problems or comments...

PBIL Back to PBIL home page