(data stored in SCRATCH zone)

EMBL: CP001069.PE297

CP001069.PE297       Location/Qualifiers
FT   CDS_pept        342782..343543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4070"
FT                   /product="RNA polymerase, sigma 28 subunit, FliA/WhiG"
FT                   /EC_number="4.1.1.65"
FT                   /note="KEGG: rso:RSp1390 flagellar biosynthesis sigma
FT                   factor; TIGRFAM: RNA polymerase sigma factor, FliA/WhiG
FT                   family; RNA polymerase sigma factor, sigma-70 family; PFAM:
FT                   sigma-70 region 3 domain protein; sigma-70 region 2 domain
FT                   protein; sigma-70 region 4 domain protein; Sigma-70 region
FT                   4 type 2"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4070"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29173"
FT                   /db_xref="GOA:B2UHX2"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR012845"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028617"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHX2"
FT                   /protein_id="ACD29173.1"
FT                   /translation="MNEASKAGMDMYTATGRKTKSDEMATYAPLVRRIANQMMVKLPAS
FT                   VELDDLIQAGMMGLLDALSRYEETQGVQFEFYAAQRIRGAILDELRGSDWLPRGLRRNA
FT                   RTIEQAIQKLQQQKGRAPTETEIAVALGMSLAEYQKQLVDLQGSQLLYYEDFDREDADA
FT                   FIENRAPENDATPLDQLLDHDLRESVVAAIEGLPEREKLMMSLYYEQDLNLREIGAVMG
FT                   VSESRVCQIHSQAIARIRSRLRDRAWLPTPT"
     atgaacgaag cgtcaaaggc aggcatggat atgtacaccg caaccggtcg caagaccaag        60
     tccgacgaga tggccacgta cgcacccctg gtgcgccgca ttgccaacca gatgatggtc       120
     aagctgccgg ccagcgttga gctggacgac ctgatccagg ccggcatgat gggcttgctc       180
     gatgcgctgt cgcgctatga ggaaacgcag ggcgtgcagt tcgagttcta cgcggcccag       240
     cgtattcgcg gcgcgatcct ggacgaactg cgcggctcgg attggctgcc gcgcggcctg       300
     cgccgcaacg cgcgcacgat cgagcaggca atccagaagc tgcagcagca gaagggccgc       360
     gcgcccaccg aaaccgagat tgccgtagcg ctgggcatgt cgctggccga atatcagaag       420
     caactggtcg acctgcaagg cagccagttg ctgtattacg aagatttcga ccgtgaagac       480
     gctgacgcct tcatcgagaa ccgcgcaccc gagaacgacg ccacgccgct ggaccaactg       540
     ctagaccacg acctgcgcga atcggttgtc gctgccatcg agggactgcc cgagcgcgag       600
     aagctgatga tgagcctcta ctacgagcag gatctgaacc tgcgtgaaat cggcgccgtg       660
     atgggcgtgt cggaatcgcg cgtgtgccag atccacagcc aggcgattgc ccgcatccgt       720
     tcgcgcctgc gcgatcgcgc atggctgccg acgccgacct ga                          762
//

If you have problems or comments...

PBIL Back to PBIL home page