(data stored in ACNUC7421 zone)

EMBL: CP001069.PE298

CP001069.PE298       Location/Qualifiers
FT   CDS_pept        343922..345349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4071"
FT                   /product="xanthine permease"
FT                   /note="TIGRFAM: uracil-xanthine permease; xanthine
FT                   permease; PFAM: Xanthine/uracil/vitamin C permease; KEGG:
FT                   rso:RSc2118 putative xanthine permease transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4071"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29174"
FT                   /db_xref="GOA:B2UHX3"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR017588"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHX3"
FT                   /protein_id="ACD29174.1"
FT                   /translation="MRQSPGQPTPSSSTIADTVADPVNEFLPLPRLFALGLQHLLVMYA
FT                   GAIAVPLIVGNALGLSKSDLSYLVNCDLFAAGIGTLIQSLGFLIFGIRLPVMMGVTFAA
FT                   VAPMIAIGVEPGMGLPGIFGASIVSGVFGIAVAPLMGRLLGLFPRVVTGTVIMLIGFSL
FT                   LSVGINWAAGGQQMIPQVVDGVRHMVPNPAFGDPFGLAIAALVLVTILLLTKFGNALLC
FT                   NIAVLLGIVTGTLVAAAFGKVSMADASAAPLMTLVTPFYFGMPKFELSAIISMCIVIVI
FT                   TLVESTGMFLALAHVVGKPISRNELTNGLRADGLATVVAGVFNTFPHTSFSQNIGLVSI
FT                   TGVRSRYVAAAGGVLLIVLGLFPKLSYVVASVPQYVLGGAGIVMFGMVAAAGIRMLGMV
FT                   DFQQQRHNLLIIAVSVGFGMMPTLAPAFFHHFPDWTRPITHSGIVMGTLVAVVLNAWFN
FT                   GIRGSHEVIHGEAAAAH"
     atgcgccaat cccccggcca acccacgcct tcttcgtcaa caatcgccga caccgttgcc        60
     gatcccgtca acgagttcct gccgctgccg cgcctgttcg cgcttggcct gcaacacctg       120
     ctggtgatgt acgccggggc gattgccgtg ccgctgattg tcggcaatgc gctcggcctc       180
     tcgaagagcg atctctcgta tctcgtcaat tgcgacctgt ttgcggctgg gatcggcacg       240
     ctgatccaat cgctcggctt cctgattttc gggatccgcc tgccggtcat gatgggcgtc       300
     acgtttgcgg cggttgcccc gatgatcgcc atcggtgtgg agcccggcat ggggctgccc       360
     ggcatcttcg gggcgtcgat cgtttccggc gtgttcggca ttgccgttgc accgctgatg       420
     gggcggctgc tgggcctgtt cccgcgcgtg gtgacgggca cggtcatcat gctgatcggc       480
     ttttcgctgc tgagcgtagg gatcaactgg gccgcgggcg gccagcagat gattccgcag       540
     gtggtggacg gcgtgcgcca catggtgccg aacccggcgt ttggcgatcc gttcggcctc       600
     gccattgcgg cgctggtgct ggtgacgatc ctgctgctga ccaagttcgg caacgcactg       660
     ctgtgcaaca tcgctgtgct gctgggcatc gtcacgggca cgcttgtcgc ggcggcgttc       720
     ggcaaggtgt caatggccga tgcgagcgct gcgccgctga tgacgctggt gacgccgttc       780
     tacttcggca tgccgaagtt cgagctgtcg gccatcatct cgatgtgcat cgtgatcgtg       840
     atcacgctgg tggaatcgac tggcatgttc ctcgcgctgg cgcacgtggt gggcaagccg       900
     atctcgcgca acgaactgac caatggcctg cgtgccgacg gtctggcgac ggtcgtggcc       960
     ggtgtgttca atacgttccc gcatacgtcg ttctcgcaga acatcgggct ggtgtcgatc      1020
     acgggcgtgc ggtcgcgcta cgtggcggcc gccggcggtg tgctgctgat cgtgctgggg      1080
     ctgtttccga agctgtctta cgtggtggca tcggtgccgc aatacgtgct gggcggcgcg      1140
     ggcatcgtga tgttcggcat ggtggccgca gccggtatcc gcatgctggg catggtcgat      1200
     ttccaacagc agcgccacaa cctgctgatc atcgcggtgt cggtgggctt tggcatgatg      1260
     ccgacgctgg cgccggcctt cttccatcac ttcccggact ggacgcgccc gatcacccac      1320
     agcggcatcg taatgggcac gctggtggcc gttgtgctga acgcctggtt caacggcatt      1380
     cgcggctcgc acgaagtgat acatggcgag gccgcagccg cacattga                   1428
//

If you have problems or comments...

PBIL Back to PBIL home page