(data stored in ACNUC7421 zone)

EMBL: CP001069.PE307

CP001069.PE307       Location/Qualifiers
FT   CDS_pept        354849..355604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4080"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; KEGG: bpt:Bpet4676 transcriptional
FT                   regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4080"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29183"
FT                   /db_xref="GOA:B2UHY2"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHY2"
FT                   /protein_id="ACD29183.1"
FT                   /translation="MKTDYEVPALKRIHDVLEILCAATSPVRPAALAQATGMSRSTLYL
FT                   LLESLEKRRWIEKQADGYLIGLTLFELGNAYFRHDSLLAAFRRESAAFVAAHNEVVQLA
FT                   VLDGTEVVYIAREDAPRPVRLVSDVGLRLPAHCCALGKALLASLDDEAVRALLPARLAA
FT                   MTERTTTRRADLLDELERIRVRGLATEREEVVAGLACFAAFVGITPLGKRVAVSSSVPV
FT                   SRLDARREKRLVVGVAGMADRIGRALAQA"
     gtgaagacag actacgaggt gccagcactc aagcgcattc atgacgtgct ggaaatactc        60
     tgcgcggcga cgtctcccgt ccggccggcc gcattggcgc aggcgacggg catgtccaga       120
     agcacgttgt acctgctgct ggagtcgctc gaaaagcgtc gctggatcga gaagcaggca       180
     gacggctatc tgatcggctt gaccctgttt gagttgggca acgcttactt ccgccacgac       240
     agcttattgg cagcgttccg gcgcgaatcc gccgccttcg tggccgcaca caatgaagtc       300
     gtgcaactgg ctgtgctcga cggtacggag gtcgtctaca tcgcgcggga agacgcgccg       360
     aggccggtcc gcctggtatc ggatgtcggc ctgcgcctgc cggcccattg ttgtgcgctg       420
     ggcaaggcgc tgctcgcaag ccttgacgat gaagcggtgc gcgcgctcct gccggctcgt       480
     cttgccgcca tgacggagcg caccaccacg cgccgcgccg atttgctcga cgagcttgag       540
     cgcattcgcg tgcgggggct ggcgacagag cgtgaggagg tggtggcggg gctcgcctgc       600
     ttcgcggcgt ttgtgggcat cacgccgcta gggaaacgcg ttgcggtgag ttcgagcgtg       660
     cccgtcagcc gactggacgc ccgcagggag aaacgcctcg tcgtcggtgt tgcggggatg       720
     gcggaccgca tcggccgcgc gctcgcgcag gcatag                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page