(data stored in ACNUC7421 zone)

EMBL: CP001069.PE310

CP001069.PE310       Location/Qualifiers
FT   CDS_pept        358820..359359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4083"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aav:Aave_1254 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4083"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29186"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHY5"
FT                   /protein_id="ACD29186.1"
FT                   /translation="MQVLSARFEKTDAGRREIAMRSGALSRSSRALLIMVDGQATGEDL
FT                   VVRAGQLGLEAQAVVELVQAGFIQSATDVAGEPVFVQVAEPQPEAPKPAAPAAPARKRS
FT                   LAAARMYLMDIAARTFSSAEHPIRQRLVEATDRASVESAFDALLAALREATSASMVEQV
FT                   EVSFRGFLPAEDGVAG"
     atgcaggtgt tatccgcacg attcgaaaag actgacgcgg ggcgacgtga aatcgccatg        60
     cgcagcggcg cgctcagccg ctcaagccgc gcgctgctca tcatggtgga cgggcaggct       120
     acgggagagg accttgtcgt acgtgccggc cagctcggcc tggaagcgca ggccgtggtt       180
     gagctggtgc aggcaggttt cattcaaagc gcaaccgatg ttgctggcga gcccgtcttc       240
     gttcaggtgg ccgagccgca acccgaggcg cccaagcccg ctgcacctgc cgcaccggcg       300
     cgcaagcgtt cgctggcggc ggcgcgcatg tacctcatgg acattgcggc acgcacattc       360
     agctcggccg agcacccgat ccgccagcgc ctggtcgagg ccaccgaccg cgcctctgtg       420
     gagagcgcgt tcgatgcgtt gctggcggcc ctgcgcgaag ccacatcggc gtcgatggtg       480
     gaacaggtgg aggtgtcgtt ccgcgggttc ctgccggccg aggacggtgt ggccggctga       540
//

If you have problems or comments...

PBIL Back to PBIL home page