(data stored in ACNUC7421 zone)

EMBL: CP001069.PE318

CP001069.PE318       Location/Qualifiers
FT   CDS_pept        complement(364165..365124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4091"
FT                   /product="PBS lyase HEAT domain protein repeat-containing
FT                   protein"
FT                   /note="PFAM: HEAT domain containing protein; PBS lyase HEAT
FT                   domain protein repeat-containing protein; KEGG:
FT                   pen:PSEEN0177 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4091"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29194"
FT                   /db_xref="GOA:B2UHZ3"
FT                   /db_xref="InterPro:IPR000357"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHZ3"
FT                   /protein_id="ACD29194.1"
FT                   /translation="MTTTPLARLHDADAATRRVALLQIADEEDADSLPNVIALLEQDPA
FT                   PEVRLEAARILATWEQPDTVAALARALEDVDGAVRDAAAIGLADLKSPESASALLAYVD
FT                   HASAFVRAAALRGLRELRVPESEAPALHALQDADAAVRREAVAVLGWRKHVGALPALAE
FT                   RARHDADVDVRRAAVGALGLATDAAVLPALLAALHDTAWRVREESASTLGKLRALAPDL
FT                   HVTQALVDALADAYWQVRLQAARALGRWRAAHAVDALAALLTHPISNLRKEAALALGEI
FT                   GEASALPALRSAQTDGDPEVVKAVRIALAQIERARASA"
     atgacgacaa cacccctggc gcgcctgcac gacgcggatg ccgccacccg ccgcgttgcc        60
     ctgctgcaga tcgccgatga agaagacgcc gattcgctgc caaacgtgat tgccctgctt       120
     gagcaagacc ctgcccccga agttcggctg gaagctgcgc gaatcctcgc aacgtgggaa       180
     cagccggata ccgtggccgc actcgcccgc gcgctggaag atgtggatgg cgccgtgcgt       240
     gatgccgcgg caatcggcct ggccgatttg aaatcgcccg agtctgcgtc cgcgctgttg       300
     gcttacgtcg accatgccag cgcctttgta cgcgccgccg cattgcgtgg gctgcgtgaa       360
     ctgcgcgtgc ccgagagcga agcacccgcg ctgcacgcct tgcaagacgc cgacgccgcc       420
     gtgcgtcgcg aggccgttgc ggtgctcggc tggcgcaagc atgtgggcgc attgcctgct       480
     ctggcggaac gcgcacgcca tgacgcggat gtcgacgtgc gccgtgccgc agtgggcgcc       540
     ctcggcctcg ccaccgatgc tgccgtgctg cccgcgctgc tcgctgcgct gcatgacacc       600
     gcctggcgcg tgcgcgagga aagcgccagc acgctcggca aactgcgggc gttggctccg       660
     gacctacatg tcacgcaggc gttggtggat gcgctggccg atgcatattg gcaggtccgt       720
     ctacaggcgg cccgcgcgct tggccggtgg cgcgccgcgc atgccgtcga tgcgctcgct       780
     gcgttgctca cgcacccaat cagcaacctg cgcaaggagg cggcactcgc actgggagag       840
     atcggcgaag cctctgccct gcccgccctg cgcagcgcac aaaccgatgg cgacccggaa       900
     gtcgtcaagg ccgtgcggat cgccttggca caaatcgagc gcgcccgtgc atccgcctga       960
//

If you have problems or comments...

PBIL Back to PBIL home page