(data stored in SCRATCH zone)

EMBL: CP001069.PE319

CP001069.PE319       Location/Qualifiers
FT   CDS_pept        complement(365132..365398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4092"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: bch:Bcen2424_1973 4Fe-4S ferredoxin,
FT                   iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4092"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29195"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHZ4"
FT                   /protein_id="ACD29195.1"
FT                   /translation="MQQTTVHFTHTPHDITSRSSAPVTIDEAKCIADKGCTVCVDVCPL
FT                   DLLAIDLTKGKAFMQFDECWYCMPCEQDCPTGAVKVDIPYLLR"
     atgcaacaga cgaccgttca tttcacccac acgccgcacg acatcacctc gcgcagcagc        60
     gcgcccgtca ccatcgacga agccaagtgc attgccgaca agggctgcac cgtgtgcgtc       120
     gacgtctgcc cactcgacct gctcgccatc gacctgacca aaggcaaggc tttcatgcaa       180
     ttcgatgaat gctggtactg catgccgtgc gagcaggact gcccgaccgg cgcggtgaag       240
     gtcgacatcc cgtacctgtt gcgttga                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page