(data stored in ACNUC7421 zone)

EMBL: CP001069.PE32

CP001069.PE32        Location/Qualifiers
FT   CDS_pept        35376..38057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3792"
FT                   /product="diguanylate cyclase with PAS/PAC sensor"
FT                   /note="KEGG: rso:RS01984 probable transmembrane protein;
FT                   TIGRFAM: PAS sensor protein; diguanylate cyclase; PFAM:
FT                   GGDEF domain containing protein; histidine kinase HAMP
FT                   region domain protein; PAS fold-3 domain protein; PAS
FT                   fold-4 domain protein; PAS fold domain protein; SMART: PAS
FT                   domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3792"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28908"
FT                   /db_xref="GOA:B2UH57"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH57"
FT                   /protein_id="ACD28908.1"
FT                   /translation="MKPTLKSQAAIMATVISVTLVSLFGWSQREPIRREMMAQIQAQQT
FT                   ALVRESADDLRQRLDIYLGVLERTARQMHTVRFDTPEQEATLFRSIRPASGLFDGVFLA
FT                   TSAGKVTATSAHRPGVVGLDITDRDYFKQIMVRGQPTISAPLRNRIGGEPIVIMAAPVH
FT                   DNDGRLVGLIGAALYLLKPNFLGLLRDMRIGKTGHVYLITQGQHPIFVVHPDPDKVLAP
FT                   LDADPAVAAALRSDPSASPERGGDVVTMQDVVATGWTLGAVLPGAEANRQLFAMHQRFR
FT                   LSLVLLAVLIGASVWAAMLWLLRPLARLHAAMSQLSTTDLRDAPPLELPDASAEIDAVS
FT                   TAFRKLMDEVARQRAELEAVNDASPLGLFRADVEGRIVYANEAYRRLLGLTHEEALADV
FT                   WLTRQHPNDREAAMTGWHEAIRRGTVYTAEQRVLVPGEGERLMVVNTAPVRVDGEVIGH
FT                   VGTMEDITVRARAQQASRVLTKILDSTTDFVAQTDVHGNVTYMNPAGRRFVGIALDQDI
FT                   RGMTVADFYPPATMDWLREVAVPAAVRDGVWIGETTVRGQQRVAVPVNHMLIAHRDPAG
FT                   HMEYFSSIMRDITQDRAAKEALQRSRETLQTVTDAMPALVAFIDVDERFRFLNAAYEKA
FT                   YGQPTAAMLGKTVCEVAGDESYRSVRDALHRALAGETIVFEREQRNREAYRCEEINYLP
FT                   QFDAHGRVAGVHSVTLDITERKKQELRLRALTTTDHLTGLLNRAGFEARLSAALDQGRV
FT                   SDTAGALLLIDLDGFKAVNDTYGHTMGDALLRTVAQRLVRAVRPSDGVARFGGDEFAVI
FT                   LENLSQPDDAKAVAASILGVCNRPFRLGERAVQVGVSIGIAGFDARTLAQGVVFEAADE
FT                   ALYEAKSRGKGLFVSADELPTG"
     atgaaaccca cactgaagtc gcaggcggcc atcatggcaa ccgtcatcag cgtgacgctg        60
     gtgagcctgt tcggctggtc gcaacgtgag ccgatccgcc gcgagatgat ggcgcagatc       120
     caggcgcagc agacggcgct ggtcagggag tccgccgacg atctcaggca gcggctggac       180
     atctacctgg gcgtgctcga acgtacggca cggcaaatgc acaccgttcg cttcgacacc       240
     ccggagcagg aggccaccct cttccggtcg atccggcctg cgagcggcct gttcgatggc       300
     gtattcctcg ccacctcggc gggcaaggtg acggccacct ctgcccaccg tccgggagtc       360
     gtgggcctcg acattacgga ccgcgattac ttcaagcaga tcatggtgag gggccagccc       420
     accatttctg cgccgttgcg caatcgcatc ggtggtgaac ccatcgtcat catggccgcg       480
     cccgtgcatg acaacgacgg ccggctggtc gggctgatcg gcgccgcgct ctacctgctc       540
     aagcccaact ttcttggcct gctgcgtgac atgcgcatcg gcaagaccgg ccacgtctat       600
     ctgattacgc aaggccagca cccgatcttc gttgtccatc ccgatcccga caaggtgctc       660
     gcaccgctcg atgccgatcc tgcagtcgct gccgcgctcc gctcggaccc gtccgcatcg       720
     cctgagcgcg gcggcgacgt cgtcacgatg caggacgtgg tcgcaacagg ctggacgttg       780
     ggggcagtgt tgccgggcgc cgaagccaat cggcagctct ttgccatgca ccagcgcttt       840
     cggctgtcgc tggtgttgct ggccgtcctg atcggcgctt cggtgtgggc ggcgatgctg       900
     tggctgctgc gcccgctggc acgactgcac gctgcgatgt cgcaactttc caccacggac       960
     ctgcgcgatg cgccaccgct tgagctgccg gatgcttcgg ccgagatcga cgccgtgtcg      1020
     accgccttcc gcaagctgat ggacgaggtc gcgcgccagc gtgccgagct cgaggccgtg      1080
     aacgacgcct ccccgctggg cctgttccgg gcagatgtcg agggccgcat cgtctacgcg      1140
     aatgaagctt atcgccggct cctcggcctc acgcacgaag aggcactggc tgacgtgtgg      1200
     ctcacgcgtc agcatcccaa cgaccgcgaa gccgccatga cgggctggca cgaagcgatc      1260
     cgccgcggca ccgtctacac cgcagagcag cgggtgctcg tgccgggcga gggcgagcgc      1320
     ctgatggtgg tcaacacggc accggtacgt gtggatggcg aggtgatcgg ccacgtcggc      1380
     accatggaag acatcaccgt gcgggcacgc gcccagcagg cttcgcgcgt gctcaccaag      1440
     atcctcgact ccacgaccga ttttgtcgcg cagaccgacg tgcacggcaa cgtcacctac      1500
     atgaacccgg ccggccgccg ctttgtcggc atcgcactgg accaggacat tcgcggcatg      1560
     acggtcgcgg atttctatcc gcccgcgacg atggactggc tgcgcgaggt ggcagtgcct      1620
     gccgctgtgc gcgacggcgt gtggattggc gagacgaccg tgcgggggca gcagcgcgtg      1680
     gcggtgcccg tcaatcacat gctcatcgcg catcgcgacc ccgcggggca catggagtac      1740
     ttctcgtcga tcatgcgcga catcacgcag gacagggcgg ctaaggaggc actgcagcgc      1800
     agtcgtgaga cgctgcagac agtgaccgat gccatgcccg ccctggtcgc cttcatcgat      1860
     gtggacgagc gcttccgttt cctgaacgcc gcgtacgaga aggcttacgg ccagcccact      1920
     gccgccatgc tcggcaagac ggtctgcgag gtggcgggtg acgagagtta tcgcagcgtg      1980
     cgcgatgccc tgcaccgcgc gctggcgggc gaaaccatcg tcttcgaacg agagcagcgc      2040
     aatcgcgagg cgtaccgctg cgaagaaatc aactatttgc cgcagttcga cgcacacggc      2100
     cgtgttgccg gtgtgcattc ggtcaccctt gatatcaccg agcgcaagaa gcaggagctg      2160
     cgtctgcgcg cgctgaccac caccgaccat ctgaccggtc tgctgaatcg cgcaggcttt      2220
     gaagcgcgcc tgtcggccgc gctggaccag gggcgcgtca gtgacacggc cggggcgctg      2280
     ctcctcatcg acctggacgg tttcaaggcc gtcaacgata cgtacggtca tacgatgggc      2340
     gacgccttgt tgcgcacggt cgcgcagcgg ctggtgcgcg cggtgcgccc cagcgacggc      2400
     gtggcgcgct ttggcgggga cgagttcgcc gtcatccttg agaacctgtc gcagccggac      2460
     gacgcaaaag ccgtcgctgc ctcgatcctt ggcgtatgca accggccctt ccgtctgggt      2520
     gaacgggcgg tgcaggtcgg ggtcagcatc ggcattgccg gtttcgacgc ccgcacgctg      2580
     gcacagggcg ttgtcttcga ggcagccgac gaggcgttgt atgaagccaa gtcgcgcggc      2640
     aagggcctgt tcgtgagcgc ggacgaactg ccgacaggct ga                         2682
//

If you have problems or comments...

PBIL Back to PBIL home page