(data stored in SCRATCH zone)

EMBL: CP001069.PE321

CP001069.PE321       Location/Qualifiers
FT   CDS_pept        complement(367122..367907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4094"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; UbiC
FT                   transcription regulator-associated domain protein; KEGG:
FT                   reh:H16_B2241 transcriptional regulator, GntR-family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4094"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29197"
FT                   /db_xref="GOA:B2UHZ6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHZ6"
FT                   /protein_id="ACD29197.1"
FT                   /translation="MTTSNLHRQPAPPLYERIKGTLREGILSGHYAPASLLPSEAALGE
FT                   QFNASRITVRQALADLQNEGLIFRRHGKGTFVSQPKAFQNVTALQGFAEAMSAQGHAIR
FT                   NRVLKLRTLPAPTDVAQALQLAPGTAVTELHRVRLLDQVPVSLEVTWLPEPLGSSVARA
FT                   DLVTRDVFLVLEQDAGVALGHATLAIDAALADHATATALDTGAGAALLRVERLTHDAQG
FT                   TPIDFERLYFRGDAFQYRLRLDRQVAAHAQSILPLQGTK"
     atgaccacct caaatttgca ccgccaacct gccccgccgc tctatgagcg catcaagggc        60
     acgctgcgcg agggcattct cagcggccac tacgcgccgg cctcgctgct gccgtcggaa       120
     gcggcgctgg gcgagcagtt caacgccagt cgcatcaccg tgcgtcaggc actggccgat       180
     ctgcagaacg aagggctgat cttccgccgt cacggcaaag gcacgtttgt gagccagccc       240
     aaggcctttc agaacgtgac ggcgctgcag ggctttgccg aggcgatgtc ggcacaaggt       300
     catgccatcc gtaaccgcgt gctgaagctg cgcacgctgc ccgcgccgac cgacgtggca       360
     caggcgctgc aactggcacc tggcacggcc gtcacggaat tgcatcgcgt gcggttgctc       420
     gatcaggtgc cggtttccct tgaggtgacg tggctgccgg agccgctggg cagcagcgtc       480
     gcgcgggcgg acctcgtcac gcgcgatgtt ttcctcgtgc tggagcagga cgcaggggtg       540
     gcgctcggtc atgcgacgct ggccatcgat gcggcgctgg ccgaccacgc caccgcaacc       600
     gcactcgaca cgggcgcagg cgcggcactg ttgcgcgtgg agcgtctgac gcacgacgca       660
     cagggcacgc ccatcgattt tgaacgcctg tattttcgcg gcgacgcttt ccagtaccgg       720
     cttcggctgg atcggcaggt ggcggcgcat gcgcaatcca tccttccttt gcaaggcacc       780
     aaatga                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page