(data stored in ACNUC7421 zone)

EMBL: CP001069.PE328

CP001069.PE328       Location/Qualifiers
FT   CDS_pept        complement(374148..374573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4101"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: syg:sync_0841 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4101"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29204"
FT                   /db_xref="InterPro:IPR024311"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI03"
FT                   /protein_id="ACD29204.1"
FT                   /translation="MTERDTKLHGSWRLLSFETELQETKERTQPWGADPNGSLIFGADG
FT                   RMMVLLTAKVREQGNTDEKLAALFRTIVAYTGRYRVEDDRFITKVDASWNEAWTGTEQE
FT                   RFYTLDGDKLEVRTAWMPNPLVSENAMGRGVLGFRRE"
     atgactgagc gcgatacgaa gctgcacggt agctggcggc tgttgtcttt cgagaccgag        60
     cttcaggaga ctaaggagcg tacgcagccc tggggcgctg atcccaatgg gtcgctgatc       120
     ttcggcgctg acgggcgcat gatggtgctc ctcaccgcga aagtgcggga gcaggggaat       180
     acagacgaga agctggcggc gctgttccgc acgatcgtgg cctataccgg gcggtatcgg       240
     gtcgaagacg atcggttcat cacgaaggtt gacgcgtcct ggaatgaagc ctggaccggc       300
     acggagcagg aacggttcta tacgctggat ggagacaagc tggaagtgcg cacggcgtgg       360
     atgccgaacc cattggtttc cgaaaacgca atgggcaggg gtgttctcgg tttcaggcgc       420
     gagtaa                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page