(data stored in ACNUC7421 zone)

EMBL: CP001069.PE329

CP001069.PE329       Location/Qualifiers
FT   CDS_pept        complement(374596..375258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4102"
FT                   /product="bifunctional deaminase-reductase domain protein"
FT                   /note="PFAM: bifunctional deaminase-reductase domain
FT                   protein; KEGG: rme:Rmet_4484 bifunctional
FT                   deaminase-reductase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4102"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29205"
FT                   /db_xref="GOA:B2UI04"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI04"
FT                   /protein_id="ACD29205.1"
FT                   /translation="MTRVRVAGFTLSLDGYGAGPDQDINNPLGIGGMELHQWLVATRTF
FT                   QRTLFGKDGGTTGVDDDFAARSFRNVGAWILGRNMFGPIRGDWPDDNWKGWWGDNPPYH
FT                   VPVFVLTHHARAPIEMAGGTTFHFITGGFREALDRAREAAGGKDVRIGGGPSTIRQYLR
FT                   EGLIDELHIAISPVLLGRGEPLFEGIDLRALGYACVESVASEKATHVVLRRPLPTNT"
     atgacacgcg ttcgcgttgc gggcttcacc ctctcgcttg acggatacgg cgcaggtccg        60
     gatcaggaca tcaacaatcc gctcggcatt ggcgggatgg agctgcacca gtggctggtc       120
     gcgacgcgca cgttccagcg gaccctgttc ggcaaggacg gcggtacaac tggcgttgac       180
     gatgactttg ccgcccgtag tttccggaac gtgggggcgt ggattctcgg gcgcaacatg       240
     ttcggcccca ttcgcgggga ttggcccgac gacaattgga aaggctggtg gggcgacaac       300
     ccgccgtatc acgttcccgt tttcgtgttg acccaccacg cgcgtgcgcc catcgagatg       360
     gcgggcggca cgaccttcca cttcatcaca ggcggctttc gagaagcgct cgaccgtgcg       420
     cgcgaggccg ctggcgggaa ggatgtacgc attggcggag ggccgagcac catccggcag       480
     tacctgcgtg aaggcctcat cgatgaactg cacatcgcga tctcgccggt cttgcttggc       540
     cgaggggaac ccctgtttga ggggatcgac ttgcgagcgc tgggctacgc gtgcgttgaa       600
     tccgtagcat cagaaaaggc gacgcatgtt gttttgcggc gcccattgcc tacgaatact       660
     taa                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page