(data stored in ACNUC7421 zone)

EMBL: CP001069.PE33

CP001069.PE33        Location/Qualifiers
FT   CDS_pept        38492..39652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3793"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   rso:RS01985 probable amino acid-binding periplasmic (PBP)
FT                   ABC transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3793"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28909"
FT                   /db_xref="GOA:B2UH58"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH58"
FT                   /protein_id="ACD28909.1"
FT                   /translation="MQKTIKRLLVTAAAAGAAIATGTTFAAQDIKIGVAEALSGGAAQY
FT                   GVAIRNGFQLAADEINAAGGINGSKIALVIEDEQGKKEEAINVFKKLIFQDKVAMVFGP
FT                   TLSNSAQAADPIAQGAKTVVFGTSNTADGVTSIGDFVFRNSVTEADVLPATIQTVVKKA
FT                   GVKKVAVLYGNDDVFTKSGYDNFKKALEDLKIPVTTTETFAKGDVDFKAQLTKIKATNP
FT                   DAIVLSALIAEGGPIMVQARQLGLNVPIIGGNGMNSVKVFDLAKDKSDNLWVGSPWSIE
FT                   NHTAENSKFITAYTAKYKAAPDQFAAQAYDAMYIASKALKTVKFSGKLEADRKAIRDAL
FT                   PGVKHIGATGAFAFRQVTARGKPAGYDAVQTPIVSVTKNGKYTIEK"
     atgcaaaaga cgatcaaacg gctgctggtg acggcggcgg ctgcgggggc ggctatcgca        60
     acgggcacga cgttcgcggc ccaggacatc aagatcggcg tggccgaggc gctgtcgggc       120
     ggtgcagccc agtacggcgt ggccatccgc aacggcttcc agctggccgc tgatgagatc       180
     aatgccgcgg gcggcatcaa cggcagcaag atcgcgctgg tgatcgaaga cgagcagggc       240
     aagaaggaag aggccatcaa cgttttcaag aagctgatct tccaggacaa ggtcgccatg       300
     gtgttcggcc ccacgctgtc caactcggca caggcagcgg acccgattgc gcagggcgcc       360
     aagacggtcg tgttcggcac ctccaacacc gctgacggcg tcaccagcat cggcgatttc       420
     gtcttccgca actccgtgac cgaagccgac gtgctgccgg ccaccatcca gactgtcgtg       480
     aagaaggcgg gcgtgaagaa ggtcgcggtg ctgtacggca acgacgacgt cttcaccaag       540
     agcggctacg acaacttcaa gaaggcgctc gaagacctga agattccggt cacgaccacc       600
     gagaccttcg ccaagggcga cgtggacttc aaggcccagc tcaccaagat caaggcgacg       660
     aatccggatg cgatcgtgct gtcggccctg attgcggagg gtggcccgat catggtgcag       720
     gcgcgtcagc ttggcctgaa cgtgcccatc atcggcggca atggcatgaa ctcggtcaag       780
     gtgttcgacc tggccaagga caagtccgac aacctgtggg tgggcagccc gtggtcgatc       840
     gagaaccaca cggccgagaa cagcaagttc atcaccgcct acaccgccaa gtacaaggca       900
     gcgccggacc agttcgccgc gcaggcgtat gacgccatgt acatcgcgag caaggcgctg       960
     aagacggtca agttcagcgg caagctggaa gccgaccgca aggcgatccg cgatgcgctg      1020
     ccgggcgtca agcacatcgg cgcaaccggc gcgttcgcat tccgccaggt gacggcgcgc      1080
     ggcaagccgg ctggctacga cgctgtgcag acgccgatcg tgagcgtgac caagaacggc      1140
     aagtacacga tcgagaagta a                                                1161
//

If you have problems or comments...

PBIL Back to PBIL home page