(data stored in ACNUC7421 zone)

EMBL: CP001069.PE330

CP001069.PE330       Location/Qualifiers
FT   CDS_pept        375434..376357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4103"
FT                   /product="putative exonuclease RdgC"
FT                   /note="PFAM: putative exonuclease RdgC; KEGG:
FT                   bch:Bcen2424_4426 recombination associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4103"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29206"
FT                   /db_xref="GOA:B2UI05"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI05"
FT                   /protein_id="ACD29206.1"
FT                   /translation="MWFKNLQLHRLPAPWAVTPDQLEKWLAPHAFQPGNSVEKQTFGWA
FT                   SPRDDGALVYSNNGQMLLVFRAEKKLLPASVINQVTKARALELEEQQGFKPGRKQLREL
FT                   KEQVTDELLPRAFSIRRDTRVWIDTANGWLVIDAASQAVADDVRGLLVKSIDQLPLTSV
FT                   HVKHSPVAAMTEWLLSGDAPGGFTVDQDAELRSTGEGGATVRYVGHALEAEDMRRHIEA
FT                   GKQCMRLAMTWDDRVSFVLTPSLLIKRVTPLDVIKEAEDPTAQNDDERFDSDVALMTGE
FT                   LARMLSDLVDSLGGDQLDAVQQAKAA"
     atgtggttca aaaatctcca gcttcatcgt ctgccggcac cttgggccgt gacccctgac        60
     cagcttgaaa agtggctggc acctcacgcg tttcaaccgg gcaacagcgt agaaaagcag       120
     accttcggct gggcctcgcc gcgtgacgac ggcgcgctcg tgtattcgaa caacgggcag       180
     atgctgctgg tattccgtgc cgagaagaag ctgctgcccg cgtccgtcat caatcaggtg       240
     accaaggccc gggcgcttga gctggaggag cagcagggct tcaagcccgg ccgaaagcaa       300
     ctgcgcgaac tcaaggaaca ggtgaccgac gaactgctgc cgcgcgcctt cagcattcgc       360
     cgcgatacgc gggtgtggat cgatacggca aatggctggc tcgtgatcga tgcagcttcg       420
     caggcggttg ccgacgacgt gcgcggcctg ctcgtcaagt cgatcgatca attgccactc       480
     accagcgtgc atgtgaagca ttcgcctgtt gcggcgatga cggagtggct gctctccggc       540
     gacgcgcccg gcggcttcac cgtcgaccag gacgccgagt tgcgctcgac gggcgagggc       600
     ggcgccacgg tgcgatacgt tggccacgcg ctggaggcag aagacatgcg ccggcacatc       660
     gaagctggca agcaatgcat gcggctcgcc atgacctggg acgaccgggt ctccttcgtg       720
     ctgacgccgt cgctcctgat caaacgcgtg acgccgctgg acgtgatcaa ggaagccgaa       780
     gaccccaccg cgcagaacga cgacgagcgc ttcgactccg atgtcgcgct gatgaccggc       840
     gagttggcgc ggatgctgag cgacctggtc gacagcctcg gcggcgatca gctcgatgcc       900
     gtgcaacagg ccaaggcggc ctga                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page