(data stored in ACNUC7421 zone)

EMBL: CP001069.PE332

CP001069.PE332       Location/Qualifiers
FT   CDS_pept        378084..379184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4107"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /note="TIGRFAM: branched-chain amino acid aminotransferase;
FT                   PFAM: aminotransferase class IV; KEGG: sme:SMc02896
FT                   branched-chain amino acid aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4107"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29208"
FT                   /db_xref="GOA:B2UI07"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005786"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI07"
FT                   /protein_id="ACD29208.1"
FT                   /translation="MNNVVESAISIEKRPNPVPAEERARLLENPAFGRVFTDHMATIRY
FT                   TEGKGWHDAKIGAHGPIQCDPSTLVLHYAQEIFEGMKAYRLPDGGGALFRPEANARRFQ
FT                   NSAKRLAMPALPEDLFLQAVRELVKLDRDWIPSGQGSALYLRPFMIATEVVLGVKPSAE
FT                   YLFCVIACPVGAYFKGDASSGVTIWVSDNYTRAAPGGTGEAKCGGNYAASLVAQAEATR
FT                   EGCDQVVFLDAVERKWIEELGGMNVFFVFDDGSLQTPPLTGTILPGITRDSLITLARGM
FT                   GLTVREEPYSIDQWQADAQSGRLREAFACGTAAVVTPIGKVKGHKHNFTIGDGKAGELT
FT                   TKLKAALVDLQNGRAPDPHGWLDRLF"
     atgaacaacg ttgtcgaatc ggctatttcg atcgagaagc gcccgaaccc tgttccggcg        60
     gaagagcgcg cgcgcctgct ggaaaacccc gctttcggcc gcgtcttcac ggatcacatg       120
     gccaccatcc gctacaccga gggcaagggc tggcacgacg ccaaaatcgg cgcgcatggc       180
     ccgatccagt gcgatccgtc cacgctggtg ctgcactacg cgcaggaaat cttcgagggc       240
     atgaaggcct accgcctgcc ggacggcggc ggtgcgctgt tccgcccgga agccaatgcg       300
     cgccggttcc agaattccgc caagcgcctg gcgatgcccg cgctgccgga agacctcttc       360
     ctgcaggccg tgcgcgagct ggtcaagctc gatcgcgact ggattccgtc gggccagggc       420
     tcggcgctgt acctgcgccc gttcatgatc gccaccgaag tggtcctggg cgtgaagcct       480
     tcggccgaat acctgttctg cgtgattgcg tgcccggtgg gcgcgtactt caagggcgat       540
     gcatcgtcgg gcgtcaccat ctgggtgtcg gacaactaca cgcgcgccgc accgggcggt       600
     acgggcgagg ccaagtgcgg cggcaactac gccgccagcc tggtcgctca agctgaagcc       660
     acccgcgagg gctgcgacca ggtcgtcttc ctcgacgcgg tggagcgcaa gtggatcgaa       720
     gagctgggcg gtatgaacgt gttcttcgtc ttcgatgacg gttcgctgca gacgccgccg       780
     ctgactggca cgatcctgcc gggcatcacg cgcgattcgt tgatcacgct ggcgcgcggc       840
     atgggcctga ccgtgcgcga agagccgtac tccatcgacc agtggcaggc cgacgcccaa       900
     agcggccgcc tgcgtgaagc ctttgcgtgc ggcaccgcag cggtcgtcac gcccatcggc       960
     aaggtcaagg gccacaagca caacttcacc atcggcgatg gcaaggcagg cgagctgacg      1020
     accaagctga aggcggcgct ggtcgatctg cagaacggcc gcgcaccgga cccgcacggc      1080
     tggctggacc gcctgttctg a                                                1101
//

If you have problems or comments...

PBIL Back to PBIL home page