(data stored in SCRATCH zone)

EMBL: CP001069.PE335

CP001069.PE335       Location/Qualifiers
FT   CDS_pept        complement(381480..381743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4110"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   pna:Pnap_4882 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4110"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29211"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI10"
FT                   /protein_id="ACD29211.1"
FT                   /translation="MDRDAFVSALRAEGFTEFVLVTREPGELDTHTHPFEAKALILAGE
FT                   IHIRAEGAERVYRPGDTFHLAANAPHTERYGAQGVQYLVARR"
     atggaccgcg acgcattcgt cagcgcgcta agagcggaag gctttacgga gtttgttctg        60
     gtgacgcgag agccgggcga gctggacacg cacacgcacc cgttcgaggc gaaagcgctc       120
     atcctggccg gcgaaattca catccgcgca gaaggcgcgg agcgcgtcta ccggcccggc       180
     gacacgtttc atctggcggc caatgcaccg cacaccgagc ggtacggcgc gcagggtgtg       240
     cagtatctgg tggcccggcg ctag                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page