(data stored in SCRATCH zone)

EMBL: CP001069.PE339

CP001069.PE339       Location/Qualifiers
FT   CDS_pept        384843..385367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4114"
FT                   /product="conserved hypothetical signal peptide protein"
FT                   /note="KEGG: rso:RS02076 hypothetical signal peptide
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4114"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29215"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI14"
FT                   /protein_id="ACD29215.1"
FT                   /translation="MMIDLRCVAMVLLLSASGAHAEDDLQNRGHDPFFQISSGVANCPE
FT                   PAGPRISEAEWKRDSHHRIEHGNHCWVEGRCRLPNAFSYDDEIAETAKRRLQWMSIHVP
FT                   GWQQNTTLWVTVWQRWMLVQGCVAPGYVLAPFMTALHDVPDVERFINETTAHPEQGVPY
FT                   AVFRKGAVAKP"
     atgatgatcg acttacgctg cgttgcaatg gtgttgctgt tgtcagcgtc tggggcgcac        60
     gccgaagacg acctgcagaa ccgcggtcac gacccgttct tccagatctc gtcgggtgtg       120
     gccaactgcc ctgaaccggc cggcccgcgc atcagcgaag ccgagtggaa gcgcgattcg       180
     caccaccgca tcgagcatgg caaccattgc tgggtggagg gccgctgccg cttgcccaac       240
     gcgttttcct acgacgatga gattgccgag acggcaaagc ggcgcctgca atggatgtcc       300
     atccacgtgc cgggatggca gcagaacacc acgctgtggg tgacggtatg gcagcggtgg       360
     atgctggtgc agggctgtgt ggcgccgggc tacgtgttgg cgccgttcat gacggcgctg       420
     catgacgtgc ctgatgtcga gcgcttcatc aacgagacga cggcacaccc ggagcagggc       480
     gtgccgtatg cggtgttccg caagggcgcg gttgccaagc cttga                       525
//

If you have problems or comments...

PBIL Back to PBIL home page