(data stored in SCRATCH zone)

EMBL: CP001069.PE343

CP001069.PE343       Location/Qualifiers
FT   CDS_pept        387783..388055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4118"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc3434 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4118"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29219"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI18"
FT                   /protein_id="ACD29219.1"
FT                   /translation="MTLTKRRVYLDGALEARTFLCRTQAYVCEFGQHRPRLLRQQLMEY
FT                   TGGAYPPAFARGFVDMIGAYLSLALERSDIDPATWELMAEVERLR"
     atgacactca ccaaacgccg agtctacctt gacggtgcgc tggaagcgcg aaccttcctc        60
     tgccgaacgc aggcctacgt gtgcgagttc gggcagcatc ggccgcgcct gctgcggcag       120
     caactgatgg agtacacggg cggcgcctat ccgcccgcat tcgcgcgcgg gtttgtcgac       180
     atgatcgggg catacctgtc gctggcactt gagcgcagcg atatcgaccc agccacgtgg       240
     gaactgatgg ccgaggtcga acggttgcgt tag                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page