(data stored in ACNUC7421 zone)

EMBL: CP001069.PE344

CP001069.PE344       Location/Qualifiers
FT   CDS_pept        complement(388079..389701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4119"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; KEGG: rso:RS04763 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4119"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29220"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI19"
FT                   /protein_id="ACD29220.1"
FT                   /translation="MATRRSFLVGAAAAGVAAAGAASWAGFRAFTEITPSVRMPGQTAG
FT                   HQLRDLRVLPAPSETRRVGVAICGSGIGGLSCAWRLAKGGRRDVVVVEGPERYGNAAGG
FT                   AFGTQRFPTGAHYLPLPSMESTHVREMLADFGVIERDPFALRPTYDERVLVHAPDERLW
FT                   LGNRWQDGFVPHEGITEAERAEHTRFFAHIDRLRQTTGADGRRVFAVPTALSSADPAWR
FT                   ALDALTFRDWLHREGYRAATLHWYADYCCRDDYGATADQVSAWAGIAYFASRGGMASNA
FT                   EQGTVLTWPEGLDWMAKRLFEAAGLDEPGRLLQGSAARIGTTNEASARVFADVLQADGR
FT                   VVRLLADHVVSAMPLHVAKHIVDGFDVPAAELPETAPWLLANLLIDGFPPEHDDTPLAW
FT                   DNVVYRGTGLGYVVANHQDIRVGPPAQSVFTAYVALSDMTPKAAREWLLKASPQTLLDR
FT                   ALADLDTVYGIRLRTQIRRADLTLRGHAMAIPTPGFLSRPGIARLRESAGPIHYAHADL
FT                   SGYSVFEEAAWWGDRAARRILGN"
     atggcaacgc gacgcagctt tcttgtgggc gcagctgcag ccggtgtggc tgccgcgggt        60
     gcggcttcgt gggcgggctt tcgcgccttt actgaaatca cgcccagcgt gcgcatgccc       120
     ggccagactg ccggccatca actgcgcgac ctgcgcgtgc tgccggcacc atcggaaacg       180
     cggcgcgtgg gcgttgccat ctgcggcagc ggcattggcg gattaagctg cgcgtggcgg       240
     ctggcaaaag gcggccggcg cgacgtggtt gtcgtcgagg gaccggagcg ctatggcaat       300
     gccgcgggcg gtgcgttcgg cacgcagcgc ttccccacgg gggcgcatta tctgccactg       360
     ccgtcgatgg aatcgacgca cgtgcgagag atgctggccg actttggcgt catcgagcgc       420
     gacccgtttg ccctgcgccc gacgtacgac gaacgcgtgc tcgttcacgc gcccgatgaa       480
     cgcctgtggc tcggcaatcg ctggcaagac ggctttgtgc cgcacgaagg cattaccgag       540
     gcggaacgcg ccgagcacac caggttcttc gcccacatcg accggctgcg ccagaccacc       600
     ggtgccgacg gccgccgcgt cttcgccgtg ccgacggcgc tctcgtccgc agacccagct       660
     tggcgcgcgc tagacgcact caccttccgc gactggctgc accgcgaggg ctaccgcgcc       720
     gccacgctgc actggtatgc cgattactgc tgccgcgacg attacggcgc cacggcggat       780
     caggtttccg cctgggccgg catcgcctat ttcgccagcc gcggcggcat ggcaagcaac       840
     gccgagcaag gcaccgtgct cacgtggccg gaaggccttg actggatggc caagcggctg       900
     ttcgaagccg ccggattgga cgaaccgggc cgtttgctgc agggcagcgc cgcgcgcatc       960
     ggtacgacga acgaggccag cgcacgcgtc tttgccgatg tgctgcaagc ggatggccgc      1020
     gtcgtgcgcc tgctagccga tcacgtggtc agcgcgatgc cgctgcacgt tgccaaacac      1080
     atcgtcgacg gctttgacgt gcccgccgcc gagttgcccg aaaccgcacc gtggctgctc      1140
     gccaacctgc tcatcgacgg ctttccgccc gaacacgacg acacgccgct ggcgtgggac      1200
     aacgtggtct atcgcggcac gggcctggga tatgtggtcg ccaatcacca ggacattcgc      1260
     gtcgggccgc ccgcgcagag cgtgttcacg gcctacgtgg cgctgtcgga catgacaccg      1320
     aaggccgcgc gtgaatggct gctgaaggca tcgccgcaaa cgctgctcga tcgtgcgctg      1380
     gccgatctcg atacggtgta cggcatccgc ctgcgcacgc agatccgccg ggccgacctg      1440
     acgctacgcg gccatgcgat ggcgattccc acaccgggct ttctctccag acccggcatt      1500
     gcgcgcctgc gtgagagcgc cgggccgatc cactacgcgc atgcggacct gtccggctat      1560
     tccgtgttcg aagaggcggc gtggtggggc gatcgggcgg cccggcgcat tctgggcaac      1620
     tga                                                                    1623
//

If you have problems or comments...

PBIL Back to PBIL home page