(data stored in ACNUC7421 zone)

EMBL: CP001069.PE347

CP001069.PE347       Location/Qualifiers
FT   CDS_pept        391904..392953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4122"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: rso:RS05341 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4122"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29223"
FT                   /db_xref="GOA:B2UI22"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="InterPro:IPR033880"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI22"
FT                   /protein_id="ACD29223.1"
FT                   /translation="MSLSSFIKKQFIDILQWTESEDGVLAWRYPMQDMEIQNGGTLVVR
FT                   DSQMAMFVNEGQIADVFGAGTFKLTTQTLPVLTYLKNWDKLFESPFKSDVYYFSTRQQL
FT                   GRRWGTPQPVTVRDKDFGMIRLRAFGVYAYHVADPKLFYQQVSGTRDIYTVDEVEAQLA
FT                   PVIMGAMATAFGESGVPFLDLAANQMLMSNKVREALLPQFTQYGLALDSFQVSSVTLPD
FT                   ELQAALDRRISMDMTGDMQRFTQYQTAESLPLAARNEGGIAGTGAGLAAGLAMGQAMAD
FT                   SLRTAVQGNAGGAAAPAAQSAAAVPAAPAADDPTARLAKLKELLDKGLITQADFDAGKA
FT                   AVLKALTGG"
     gtgagcctgt ccagtttcat caagaagcag ttcatcgaca tcctgcaatg gacggagagc        60
     gaagacggcg tgctcgcctg gcgctatccg atgcaggaca tggaaatcca gaacggcggc       120
     accctggtcg tgcgcgactc gcagatggcg atgttcgtca acgaaggcca gatcgccgac       180
     gtatttggcg ccggcacctt caagctgacc acgcagacgc tgcccgttct cacgtacctg       240
     aagaactggg acaagctgtt cgagtccccc ttcaagtccg acgtctacta cttcagcacg       300
     cgccagcaac tgggccgccg ctggggtacg ccgcagcccg tgacggtgcg cgacaaggat       360
     ttcggcatga tccgcctgcg cgcctttggc gtgtacgcct accacgtggc cgatccgaag       420
     ctcttctacc agcaggtgag cggcacacgc gacatctaca ccgtggatga agtcgaggcg       480
     caactcgccc ccgtcatcat gggtgcgatg gcgacggcgt ttggcgaatc cggcgtgccc       540
     ttcctggacc tggccgccaa ccagatgctg atgtcgaaca aggtgcgcga ggcgctgctg       600
     ccgcagttca cgcagtacgg cctggcgctc gacagcttcc aggtgtccag cgtcacgctg       660
     ccggacgaac tgcaggccgc gctggaccgc cggatcagca tggacatgac cggcgacatg       720
     cagcgcttca cgcaatacca gacggccgaa tcgctgccgc tggcggcacg caacgaaggc       780
     ggcatcgccg gtacgggtgc gggtttggcg gcagggctgg caatgggcca ggcgatggcc       840
     gacagcctgc gtaccgctgt gcagggcaac gctggcggtg cggctgctcc tgcagcgcaa       900
     tctgccgccg ccgtcccagc tgctccggca gcggacgacc ccaccgcacg cctggccaag       960
     ctcaaggaac tgctcgacaa gggcctcatc acgcaagcgg acttcgatgc cggcaaggct      1020
     gccgtgctga aggcgctgac cggaggctga                                       1050
//

If you have problems or comments...

PBIL Back to PBIL home page