(data stored in SCRATCH zone)

EMBL: CP001069.PE348

CP001069.PE348       Location/Qualifiers
FT   CDS_pept        393041..394486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4123"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: rso:RS05340 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4123"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29224"
FT                   /db_xref="GOA:B2UI23"
FT                   /db_xref="InterPro:IPR025235"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI23"
FT                   /protein_id="ACD29224.1"
FT                   /translation="MFHANCPACGAPVELKSAAAVMAVCSFCKSTLLRDGETLSDIGKM
FT                   SAVLEDYARVQIGTTGRYKNKAFTIVGRIQLRYDAGFWNEWYVLFDDGSDGWLAEASGQ
FT                   VTMTFARGTPANAVAFEGLRPGQLYDAEGKQFTLSDVREADCTGGQGELPFRVGEGWHA
FT                   RVADGRREDAFITLDYSDGTAPALYVGEATTLDVLECQLLRTDAEIKETAGRIPGKLTN
FT                   LDCPQCGTSIPFSPGVTGHVLCPGCGAAIDAATPRGDIIARARSVPQVATTLELGDKAL
FT                   IDGLQWQVIGVMRRAVVDGGGEWFEYLLYTPKRGFSWMVETDDGWFRANVLDRWPTRND
FT                   GRTAVLDGKVYARDEDYTSRVTYAAGAFNWRVQTGDQTRVVEYTAGGESLAAESDAHEL
FT                   TWSKSTPVSAAQIKAWFGKVVAEPAKASSNYMTVAVVACVLLGLLNLVPFFMAPGSVFG
FT                   ITFFAALLLLVPAWLVAKIGGGE"
     atgtttcatg ccaactgccc ggcgtgtggc gcgccggtgg aactgaagtc tgcagctgcc        60
     gtcatggcgg tgtgcagctt ctgcaagagc acgttgctgc gcgacggcga gacgctttcc       120
     gacatcggca agatgtccgc cgtgctggag gactacgcac gcgtgcagat cggcaccacc       180
     gggcgctaca agaacaaggc gttcacaatt gtcggccgca tccagctgcg ttacgacgcg       240
     ggtttctgga acgagtggta cgtgctgttt gacgacggct ccgatggctg gctggcggaa       300
     gcgtccggac aagtcacgat gaccttcgcg cgcggtacgc ctgccaatgc ggtcgcgttt       360
     gaggggctgc gcccggggca gctgtacgat gccgagggca agcagttcac gctgtccgac       420
     gtgcgcgaag ccgattgcac cggcggccag ggcgaattgc cgttccgcgt gggcgaaggc       480
     tggcacgcgc gtgtggccga tggccgccgc gaagacgctt tcatcacgct ggactactcc       540
     gatggcacgg cgccagcgct ctacgtgggc gaagccacca cgctcgatgt gctcgagtgc       600
     cagcttctgc gcaccgacgc cgagatcaag gaaaccgccg gccgcattcc gggcaagctg       660
     acgaatctcg attgcccgca gtgcggcaca tcgatcccat tcagccccgg cgtaacgggc       720
     cacgtgctgt gccccggctg cggcgcggcc atcgatgcgg ccacgccgcg cggcgacatc       780
     atcgcgcgcg cacggtcggt gccgcaggtg gccaccacgc tggagctggg cgacaaggcg       840
     ctcatcgatg gcctgcaatg gcaggtgatc ggcgtgatgc gccgcgcggt ggtcgacggc       900
     ggcggcgaat ggttcgaata cctgctgtac acgcccaagc gcggtttcag ctggatggtc       960
     gaaaccgatg acggctggtt ccgcgccaac gtgctcgacc gctggcccac ccggaacgac      1020
     gggcgcaccg cggtgctcga cggcaaggtc tacgcccgcg acgaggacta cacctcgcgc      1080
     gtgacctacg ccgccggggc cttcaactgg cgcgtgcaaa caggtgacca gacgcgcgtt      1140
     gttgaataca ccgccggcgg ggaaagcttg gctgcggaga gcgacgcgca tgagctcacg      1200
     tggtcgaaga gcacgcccgt gagtgccgcg cagatcaagg cctggttcgg caaggttgtc      1260
     gccgagccgg ccaaggcgtc gtcgaattac atgacggtgg cggtggtcgc ctgtgtgctg      1320
     ctcggtctgc tgaacctcgt gccgttcttc atggcgccgg gctcggtgtt tggtatcacg      1380
     ttcttcgcgg cgttgctgtt gctggtgccc gcgtggctgg tcgccaagat tgggggcggg      1440
     gaatga                                                                 1446
//

If you have problems or comments...

PBIL Back to PBIL home page