(data stored in SCRATCH zone)

EMBL: CP001069.PE349

CP001069.PE349       Location/Qualifiers
FT   CDS_pept        394483..394671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4124"
FT                   /product="putative serine-rich transmembrane protein"
FT                   /note="KEGG: rso:RS05339 probable serine-rich transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4124"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29225"
FT                   /db_xref="GOA:B2UI24"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI24"
FT                   /protein_id="ACD29225.1"
FT                   /translation="MKNWFVLYAVAVVIGATYMDWKAGFAAPRTPSYGSSSGGSSSYWG
FT                   GSSGGSGYGGGFSGGHK"
     atgaagaact ggttcgttct ctatgccgtg gccgtggtga ttggcgccac ctatatggac        60
     tggaaggccg gctttgccgc gccgcgcacg ccgtcgtacg gcagcagctc gggcgggtcg       120
     tcgtcttact ggggcggctc atcgggcggc agcggttatg gcggtggttt tagcgggggc       180
     cacaagtga                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page