(data stored in SCRATCH zone)

EMBL: CP001069.PE353

CP001069.PE353       Location/Qualifiers
FT   CDS_pept        397763..399235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4128"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rso:RS05323 probable transporter transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4128"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29229"
FT                   /db_xref="GOA:B2UI28"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI28"
FT                   /protein_id="ACD29229.1"
FT                   /translation="MTAASHICRFCPRPMPTTPSASLDTSLKPLLWLVAMGLFMQTLDS
FT                   TIVNTALPAMARSLSESPLKMQSVIIAYTLTTAMLMPASGWLADRFGTRKMFFAAIFLF
FT                   TIGSLLCAESRSLTMLIASRVVQGVGGALLMPVGRLTVLRVVPREQFLPAMSFVTIPGL
FT                   IGPLIGPTLGGWLVEAVSWHWIFLINIPVGVIGALVTLKVMPDVHAEDDSRFDWSGYLM
FT                   LAFGMAAVSFSLDGLSELGFQHATVLVLLVFGLAALTAYWLHAGRVAGPLFPRTLFGIP
FT                   SFSIGVLGNLFARIGSGGMPFLIPLLLQVSLGYTPLQAGLMMVPVAAAGMAAKPLGTWA
FT                   IKRYGYRRMLSVNTVMVGLMMASFAVMTPNVPVWLRIVQLAIFGTFNSMQFTAMNTLTL
FT                   KDLTGPLASAGNSMLSMVMMLSMSLGVAAAGALLTGFTDFTAGPEGRDTLAAFHKTFVC
FT                   VGVMTCAAAWIFAQLSRFESTHVVKRPEMEVH"
     atgacggctg cgtcgcacat ctgccggttc tgcccccgcc ccatgcccac cacgccctcc        60
     gcctccctcg acacctctct gaaaccgttg ctctggctgg tggcgatggg actgttcatg       120
     cagacgctcg attccacgat cgtcaacacc gcgttgccgg ccatggcacg cagcctgtcg       180
     gaaagcccgc tgaagatgca gtcggtcatc atcgcctaca cgctgacgac cgccatgctg       240
     atgcctgcgt cgggatggct ggccgatcgc ttcggcacgc ggaagatgtt ctttgctgcc       300
     atctttctct tcaccattgg ttccttgctc tgcgcggagt cccgcagcct gaccatgctg       360
     attgcctcgc gcgtggtgca gggtgtgggc ggcgcgctgc tgatgcccgt ggggcggctg       420
     acggtgctgc gcgtggtgcc gcgcgagcag ttcttgccgg ccatgagttt cgtcaccatc       480
     cccgggctga tcggcccgct gatcggcccg acgctggggg gctggctggt ggaagccgtg       540
     tcgtggcact ggatcttcct gatcaacatt cccgtgggcg tgatcggcgc gctggtcacg       600
     ctcaaggtga tgcccgatgt gcacgcagaa gacgacagcc gcttcgactg gtccggctat       660
     ctgatgctgg ccttcggcat ggcggcggta tcgttttcgc tcgacgggct gtcggagctc       720
     ggcttccagc acgcgacggt gctggtgctg ctggtcttcg gtctggccgc actcaccgcc       780
     tattggctgc acgcggggcg tgtggccggg ccgctgtttc cgcgcacgct gttcggtatt       840
     ccgagctttt ccattggtgt gctcggcaac ctgtttgcac gcatcggcag cggcgggatg       900
     ccgttcctca ttccgctgct gctgcaggtg agcctggggt acacgccgct gcaggcgggg       960
     ctgatgatgg tgccggtggc cgcagccggc atggccgcca agccactggg cacctgggcc      1020
     atcaagcgct acggctatcg ccgcatgctg tccgtcaaca cggtcatggt cggcctgatg      1080
     atggccagct ttgccgtgat gacgcccaac gtgccggtgt ggctgcgcat cgtgcaactg      1140
     gcgatcttcg gcacgttcaa ctcgatgcag ttcacggcca tgaacacgct cacgctcaag      1200
     gacctgacgg gccccctggc cagcgcgggc aacagcatgc tctcgatggt gatgatgctg      1260
     tcgatgagcc tgggcgtggc cgcagccggc gcgttgctga cgggctttac cgacttcacc      1320
     gccggaccgg aagggcgcga cacgctggcg gcgttccaca agacgtttgt ctgcgtgggc      1380
     gtcatgacct gcgcggctgc gtggatcttt gcccagctct cgcgcttcga gtcaacgcac      1440
     gtcgtcaagc ggcccgagat ggaagtgcat tga                                   1473
//

If you have problems or comments...

PBIL Back to PBIL home page