(data stored in ACNUC7421 zone)

EMBL: CP001069.PE354

CP001069.PE354       Location/Qualifiers
FT   CDS_pept        complement(399261..401411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4129"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: rso:RS05321 probable
FT                   ATP-dependent DNA helicase II protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4129"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29230"
FT                   /db_xref="GOA:B2UI29"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI29"
FT                   /protein_id="ACD29230.1"
FT                   /translation="MLAASPTPDTANAPATPGYLAQLNDQQRQAVEFGISGADAAETGP
FT                   LLVLAGAGSGKTHTLGWRVAHLVANGADPQRILLLTFSRRAASELSNRAGHLLARAMQG
FT                   ERSNNALNSAGTSYKTTLPWAGTFHGIGARLLREYAERVGLAPDFTIHDRSDSADLLNV
FT                   VRHELNLSTKERRFPLKQTCIAIYSRAINAESPLNAVLKHHFPWCAMWETQLRTLFDAY
FT                   VEAKQAQHVLDYDDLLLYWHAMVSDAELAAEIGARFDHILVDEYQDTNRLQSSILRALR
FT                   PDGRGVTVVGDDAQSIYAFRAATVRNILDFPRHFSRPAHTVLLERNYRSTQPILDASNG
FT                   VMRFATERFAKTLWTDRASTHRPRLISVRDEAEQARCVAEQVLHHREGGLTLKSQAVLF
FT                   RTASHSAPLEIELTRRNIPFVKYGGLKFLEAAHVKDVLSVLRWAENPRNRIAGFRVIQL
FT                   LPGAGPATAARVLDAMAEAADPIAALLAYEPPARLAGDWSTLMALMQTLRVPKDSLEWA
FT                   GELEAVGAWYSPHMERLHDDAAVRQGDLDQLARMAATYATRERFLTEMTLDPPELTSDE
FT                   SGDPYRDEDYLILSTIHSSKGQEWKAVYVLNAVDGCMPADLGAGSHEELEEERRLLYVA
FT                   MTRAREHLDILVPQRFYVTQQTPNGDRHIYASRTRFIPPALLPLFEACAWPEPEPGADP
FT                   AAEARAAAKVDLSKKMRGYWKK"
     gtgcttgccg cctcccccac cccagacacc gccaatgcgc cggccacgcc gggttacctg        60
     gcccagctga acgaccagca gcgccaggca gtcgagttcg gtatctctgg agcggacgcg       120
     gcggaaaccg ggccgctgct cgtgctggcc ggcgcagggt ccggcaagac gcacacgctg       180
     ggctggcgcg tggcgcatct ggtggccaac ggcgccgatc cgcaacgcat cctgctgctg       240
     acgttttccc gccgggcggc gagcgaactg tcgaaccgtg ccggccacct gctggcgcga       300
     gccatgcagg gcgagcgatc gaacaacgcc ctcaattcgg ccggcacgtc gtacaagacc       360
     acgctgccct gggcgggcac cttccacggc atcggcgcgc gcctgctgcg cgaatatgcc       420
     gagcgcgtgg gcctcgcccc cgatttcacc atccatgacc gcagcgactc ggccgatctg       480
     ctcaacgtcg tgcgccatga gctgaacctg tcgaccaagg aacgccgctt cccgctcaag       540
     cagacctgca ttgcgatcta ctcgcgcgcc atcaacgccg agagcccgct gaacgccgtg       600
     ctgaagcacc attttccgtg gtgcgcgatg tgggaaacgc aattgcgcac gctgttcgat       660
     gcgtatgtcg aagccaagca agcgcagcac gtgctcgact acgacgacct cctgctctac       720
     tggcacgcga tggtgtccga cgccgaactg gcggccgaga ttggcgcccg tttcgaccac       780
     atcctcgtcg acgaatacca ggacaccaac cggttgcagt catccatcct gcgtgcgttg       840
     cgcccggacg gccgcggtgt gaccgtggtg ggcgacgacg cgcaatcgat ctacgcattt       900
     cgcgcggcga cggtacgcaa catcctcgat tttccgcgcc acttctcgcg gccggcgcac       960
     acggtgctgc tggagcgcaa ttaccggtca acgcaaccga ttctggatgc ctccaacggc      1020
     gtgatgcgtt ttgccacgga gcgctttgcc aagacgttgt ggacggaccg cgcatcgacg      1080
     catcggccgc gcttgatttc agtgcgtgac gaggccgagc aggcgcgttg cgtggctgag      1140
     caggtgctgc atcaccgtga aggcgggctg acgctgaaat cgcaggcggt gctgtttcgc      1200
     accgcgagcc acagcgcgcc gctggagatc gaactcacgc gccgcaacat cccgttcgtg      1260
     aaatacggcg gcctcaagtt tctggaggcg gcacatgtga aggatgtgct gtcggtactg      1320
     cgctgggccg agaacccgcg caaccgcatt gccgggtttc gcgtgatcca gttgctgcca      1380
     ggtgcaggcc ccgccacggc ggcacgcgtg ctcgacgcca tggcggaagc ggcggacccg      1440
     attgccgcgc tgctcgccta cgagccaccg gcgcggctgg ccggcgactg gtctacgctg      1500
     atggcgctca tgcaaaccct gcgcgtgccc aaagacagcc tggaatgggc tggcgaactc      1560
     gaagccgtag gcgcttggta ctcgccgcac atggagcgcc tgcacgacga cgcggccgtg      1620
     cgccagggcg atctcgacca gctcgcccgc atggccgcaa cgtacgccac ccgggagcgc      1680
     ttcctgaccg agatgacgct cgacccgccc gagttgacca gcgatgaatc gggcgaccca      1740
     taccgcgacg aggactacct gatcctctcg acgatccatt cgtcgaaagg tcaggaatgg      1800
     aaggcggtgt atgtgctgaa tgccgtggac ggctgcatgc cggccgatct gggcgccggc      1860
     tcgcacgaag aactggaaga agaacgccgg ctgctctacg tggcgatgac ccgtgcgcgt      1920
     gagcacctcg acatcctggt gccccagcgt ttctacgtca cccagcaaac acccaatggc      1980
     gatcggcaca tctacgcgtc gcgcacgcgc ttcattccgc ctgcgctgct gccgctgttc      2040
     gaagcctgcg catggccgga accggagccc ggtgcagacc ccgcagccga ggcgcgtgcc      2100
     gcggccaagg tcgacctgag caagaagatg cgcggctact ggaaaaagta g               2151
//

If you have problems or comments...

PBIL Back to PBIL home page