(data stored in ACNUC7421 zone)

EMBL: CP001069.PE356

CP001069.PE356       Location/Qualifiers
FT   CDS_pept        complement(401976..402308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4131"
FT                   /product="protein of unknown function UPF0060"
FT                   /note="PFAM: protein of unknown function UPF0060; KEGG:
FT                   bur:Bcep18194_A4425 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4131"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29232"
FT                   /db_xref="GOA:B2UI31"
FT                   /db_xref="InterPro:IPR003844"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2UI31"
FT                   /protein_id="ACD29232.1"
FT                   /translation="MELLRIAVLFAFTAVAEIVGCYLPWLVLRQGKPFWLLLPAAASLA
FT                   LFAWLLTLHPAAAGRTYAAYGGVYIAVALVWLRLVDGVALTRWDVGGAAIALTGMAVIA
FT                   LQPQAN"
     ttggaactgc ttcgtattgc cgtgctgttt gccttcaccg ccgtggcgga aatcgtcggt        60
     tgttatctgc cgtggctcgt gctccggcaa ggcaagccgt tctggctcct gctgccggcg       120
     gccgcctcgc tcgcgctgtt tgcgtggttg ctgacattgc acccggctgc ggccggccgc       180
     acctatgcgg catacggcgg ggtgtatatc gccgtggcgc ttgtgtggct gcgtctggtc       240
     gacggtgtgg cgctcacccg ctgggacgtc ggcggcgcgg ctatagcgtt gacggggatg       300
     gccgtgatcg ccctgcaacc gcaggccaat tga                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page