(data stored in ACNUC7421 zone)

EMBL: CP001069.PE361

CP001069.PE361       Location/Qualifiers
FT   CDS_pept        405891..408209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4136"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: rso:RS05316 putative ferrisiderophore
FT                   receptor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4136"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29237"
FT                   /db_xref="GOA:B2UI36"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B2UI36"
FT                   /protein_id="ACD29237.1"
FT                   /translation="MSFHKRAGAAALKRTLVCRAALALSAAAPLSAFAAEDAASVPAPV
FT                   TQELAPTVVRANANPAPFARNTPAVVQSVTADQLADRNVVTAEDAVKYQPNVMVRRRFI
FT                   GDRNSIFAGRDFNEIQSARGLLYADGILLSNLLGSSYSYPPRWSMVGPDELARVDILYG
FT                   PFSALLPGNSMGTTIAMTLRRPEKFEAAAQTQIMSQHYNDAYGFSRNVTGNHESASLGD
FT                   RIGKFWYALSVDRLENDSQPMQYATPNSRFTAGGTPVPVTGARQDLGPNGQPRVILGPQ
FT                   MLERTQQLQETLRFGYVFSDSLEASLTLGHWENHFNDQALSFLRDAAGNTVTGGNVLIN
FT                   GTPYTIAPNTFAPQNGDQENWLYGLGVKGKIGGWKIDTNASAYNVSRDILRASNTAAGN
FT                   GPGTVFYGDGTGWSNFDIKATSPTVSGHTFTTGYHYDQYHLRNQTFNASNWSTETLSTL
FT                   KSSYQGDTQTQAVFLQDAWAFAPRWLATLGLRYESWRAYNGQLGNGTSALGYASRTEDA
FT                   FSPKAAIQWQATQDTLLRLSYGCAVRFPTVAELFQGTISGNTIVNNDPNLKPERANDFD
FT                   FTVEQAVPYGVLRTSLFQSDVRDSIYTQTNITVTPNVTNVQNVDRVRTRGIELAYSGQE
FT                   VLQDAGVRGVDVEANVAFTQSKTLADAANPTYVDKTWPRMPRVRANLFASWHATPDWTV
FT                   GAGVRYSGRQYGTLDNTDVLPNVYGGTSSFFTVDLKASYRIDKHITLALGVDNLTDRRY
FT                   FVYHPYPSRTFYGQLKWRL"
     atgtcattcc acaagcgcgc tggggccgcc gcccttaagc gcacgctcgt gtgccgcgct        60
     gcgctcgcgc tgagcgcagc agcaccactg tctgctttcg ctgccgagga tgcggcatcc       120
     gtgcccgcgc ccgtcacgca ggaacttgcg cccaccgtgg tgcgggccaa cgccaacccc       180
     gcgccgttcg cccgcaatac gccggcggtc gtgcaaagcg tcacagccga tcaactggcc       240
     gatcgcaacg tcgtcactgc cgaagacgcc gtcaaatacc agcccaatgt gatggtgcgc       300
     cgccgcttca ttggcgaccg caactccatc ttcgccggcc gcgacttcaa cgagatccaa       360
     agcgcacgcg gtctgctgta tgccgacggc atcctgctct cgaacctgct tggctccagt       420
     tacagctacc cgccgcgctg gtccatggtc gggccggatg aacttgcgcg cgtcgatatt       480
     ttgtatgggc cgttctcggc gctgctgcct ggcaactcga tggggacgac catcgcgatg       540
     accttgcgcc gcccagaaaa attcgaggcc gcggcgcaga cgcagatcat gagccagcat       600
     tacaacgatg cctacggctt ttcgcgcaac gtcaccggaa accacgaaag cgcatcgctg       660
     ggcgaccgca tcggcaagtt ctggtatgcg ctgtcagtcg accggctgga gaacgacagc       720
     caaccgatgc aatacgccac gcccaactcc cggttcaccg caggcggcac gccggtgccg       780
     gtcacgggtg cgcggcagga tctcggcccc aatggccagc cgcgcgtgat tctcgggccg       840
     cagatgctgg agcgtacgca gcaactgcaa gagacgctgc gattcggcta cgtattcagc       900
     gacagcctgg aggcgtcgct cacgctgggc cactgggaga accacttcaa cgatcaggcg       960
     ctcagcttcc tgcgcgatgc cgccggcaac accgtcacgg gcggcaatgt gctgatcaac      1020
     ggcacgccgt acacgatcgc cccgaacacc ttcgccccgc aaaacggcga ccaggaaaac      1080
     tggctctacg gcctgggcgt gaagggcaag atcggcggct ggaagatcga caccaacgcg      1140
     tcggcctaca acgtctcacg tgacatcctg cgcgcgtcga acacggcggc cggcaatggg      1200
     cccggcacgg tgttctacgg cgacggcacg ggctggtcca acttcgacat caaggcgacg      1260
     tcgcccacgg tgtccggcca taccttcacg accggctacc actacgacca ataccacctg      1320
     cgcaaccaga ccttcaacgc gagcaactgg tcaacggaaa cactatccac gctcaaatcc      1380
     agctaccagg gcgacacgca aacgcaggcc gtcttcctgc aggacgcgtg ggcgtttgcg      1440
     ccgcgctggc tggccacact gggcctgcgc tacgaaagct ggcgcgccta caacggccag      1500
     ctcggcaacg gcacgagcgc gttgggctac gccagccgta ccgaagacgc gttttcgccc      1560
     aaggcggcca ttcaatggca ggccacgcaa gacacgctgc tgcgcttgtc gtatggctgc      1620
     gccgtgcgct ttccgacggt ggcggagctg ttccagggca cgatcagcgg caacacgatc      1680
     gtcaacaacg acccgaacct caaacctgag cgcgccaatg atttcgactt caccgtcgag      1740
     caggctgtgc cctacggcgt attgcgtacc agcctgttcc agagcgacgt gcgcgacagc      1800
     atctacacgc agaccaacat caccgttacg cccaacgtga cgaacgtgca gaacgtcgat      1860
     cgcgtgcgca cgcgcggcat cgagttggcg tattcggggc aggaggttct gcaggatgcg      1920
     ggtgtgcgcg gcgtggacgt tgaagccaac gtcgctttca cgcaatcgaa gacgctggcc      1980
     gacgccgcca acccgaccta cgtcgacaag acctggccgc gcatgccgcg ggtgcgcgcc      2040
     aatctctttg cgagttggca tgccacgcct gactggacgg tgggcgcggg cgtgcggtat      2100
     tccgggcggc agtacggcac gctcgacaac accgatgtgc tgccgaacgt ctacggtggc      2160
     acgagcagct tcttcaccgt ggacctcaag gctagctacc gtatcgacaa gcacatcacg      2220
     ctggcgctgg gcgtcgacaa tctgaccgac cggcggtact tcgtgtacca cccgtatccg      2280
     tcgcgcacct tctatggaca actgaaatgg cgtctgtaa                             2319
//

If you have problems or comments...

PBIL Back to PBIL home page